KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I0270Help
Entry
LEPBI_I0270       CDS       T00693                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lbi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:264050..264523
Genome map
AA seq 157 aa AA seqDB search
MKYSNIAFLSLGSNIGDRHHFMDQAIWEISTLPELQILKQSERLETAPLENTNQPYFLNQ
ILKVMVSSAFTLPCLLDSLQGIEDKLGRKRRSWKGPREIDIDILTYEAVVMKTDFLHLPH
HSLYSRPFIKQLLTDMGEIGVYALYTELNHEKHYSTV
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattccaatattgcctttttgtctttaggatccaacataggtgacagacaccat
tttatggaccaggcaatttgggaaatatccaccttacctgaattacagattctgaaacaa
tcagaacggttggaaactgcaccactcgaaaataccaaccaaccttattttttaaatcaa
atcctaaaggtgatggtgtcctctgctttcacactgccatgtttattagattctttgcaa
gggatcgaagacaaattgggacgcaaacgtaggtcttggaaaggaccacgcgaaattgat
atcgatattctcacttacgaagccgtggtgatgaaaacagattttttacatttaccccac
cattccctgtattccagaccattcattaagcagttgttaactgacatgggtgagattggt
gtgtatgccctctatacggaactgaaccatgaaaaacattattctacagtataa

DBGET integrated database retrieval system