KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I0286Help
Entry
LEPBI_I0286       CDS       T00693                                 

Gene name
choB
Definition
(GenBank) Cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    LEPBI_I0286 (choB)
Enzymes [BR:lbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     LEPBI_I0286 (choB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N DAO NAD_binding_8 Pyr_redox_2 FAD_binding_2 FAD_binding_3 Thi4 HI0933_like GIDA FAD_oxidored Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ABZ96430
UniProt: B0SJ20
Position
I:279645..281393
Genome map
AA seq 582 aa AA seqDB search
MNQTIPKEQKFDYDVIIVGSGFGGSVSAYRLSQKGYKVLVIESGKRWKAGDFPKTNWSLR
KYLWMPKLGFYGIQRINLLNDFLLVSGSGVGGGSLVYACTLYVPSSKVLNSPLYSKMGGE
KALLPYYVVAKHMLGVTENPQLWEPDHLLLETAKSFGKEDTFRRTPVGIYFGNKKDLKDP
FFEGDGPDRDPCNYCGGCMVGCRHNAKNTLDKNYLYLAEKLGAVILPETKVTSLIPLNEK
GIPDPEASGEFGYELETKSTTGWFGYPKSKFRSNQVVLSAGVMGTVGLLLKMQQENKMIR
LSEKLGDTVRTNSETVLPVTVPASHNADYSRGIAITSSVHPDENTHIEPVRYSKGSDFFG
VLASVMTDGGGKFPRPLKFFWTMVRHPLYFLKAHNPFGFAKNSIILLVMQTVDNSVRLVR
KRRFIWPFQRTITSALSTGEPTPTYIPIANAFTRKLAEIVGGIPRSSLNETLLSAPVTGH
IMGGCIVAESPEKGVIDLENKVFGYENLRVCDASMLTVNLGVNPSLTITALSERAMSLIP
PKETTQIQFLKFEVKRGFDKTIAFKPTKRVVKKSTTTRKQLS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaaccattccaaaagaacaaaaatttgattacgacgtgatcatcgttgggtca
ggatttggtggttctgtttctgcgtatcgtctttcgcaaaaagggtacaaagtattagtc
atagaatccggaaaaagatggaaggcaggtgactttcctaaaaccaattggagtctacga
aagtatttgtggatgcccaaattaggtttttatggaatccaacgaatcaatttactgaat
gattttttacttgtgagcggatcaggtgttggtggtggctcactcgtatatgcctgtact
ttatatgtgccttcatccaaagttttaaattcaccattgtattccaagatgggtggagag
aaagctttgttaccttattatgttgtagcaaagcatatgttaggtgttacggaaaatcca
caattgtgggaaccagatcatttattacttgaaacggcaaaatcatttggaaaagaagat
acattccgaaggacaccagttggaatttatttcggaaacaaaaaagatcttaaagatcct
ttttttgaaggagatggccctgaccgtgatccttgtaattattgtggtggttgtatggtg
gggtgccgacacaatgcaaaaaatacattggataaaaactatttgtacttagcagaaaag
ttaggtgctgtcatattacctgaaacaaaggtaacttcactcatccctctcaatgaaaaa
ggaatcccagatcctgaagcaagtggcgaatttggatatgagctggaaaccaagagtaca
actggttggtttgggtatcctaaaagtaaatttcgttcgaatcaagtggttctatctgct
ggagtcatgggaactgttggcttactcctcaagatgcaacaagaaaacaaaatgatccga
ttgtcagagaagttaggtgatacggttcgtacgaatagtgagactgttttgccagtcaca
gtaccagcaagtcacaatgctgactattccagagggattgctatcacatcctcagtccat
cctgatgaaaatactcacattgaacctgtacgttattccaaaggttctgatttttttgga
gtccttgccagtgtgatgacagacggtggtggaaagtttccaaggccattgaaatttttt
tggaccatggtgcgccacccactttattttttaaaggcccacaatccgtttggttttgca
aaaaactcgatcatcttacttgtcatgcaaacggtagacaatagtgtgcgactggttcga
aagaggcgcttcatttggcccttccaaagaacgatcacttcagccctgtccacaggagag
ccaacaccaacatacattccgatcgccaatgcgtttactcgaaaattagcagaaattgtt
ggtggaatcccacgtagttctcttaacgaaactttactatcggcacctgtgacaggtcac
atcatgggtggttgtattgttgccgagtcaccagagaaaggtgtgattgatttggaaaac
aaagtatttggatacgagaatttacgagtttgtgatgcttcgatgttaacagtcaacttg
ggtgtgaatccaagtcttaccatcactgctttatcggaacgtgcgatgagccttatccca
ccaaaagaaacaacacagattcaatttttgaagtttgaagtgaaacgtggatttgacaaa
acaattgccttcaaacccactaaacgtgttgttaaaaaatcgacaacgacaaggaaacaa
ttatcgtaa

DBGET integrated database retrieval system