KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I0635Help
Entry
LEPBI_I0635       CDS       T00693                                 

Definition
putative glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lbi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lbi00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:640416..640889
Genome map
AA seq 157 aa AA seqDB search
MTFHDLKTITIQGKEISLGEYKGHPVLVVNVASKCGYTPQYEGLEKLHLAYKDKGLKVVG
FPSNDFGGQEPGTEAQIAEFCKLNFGVSFDLMKKTKVLGNDKDPVYQFLTENAKEKGDVK
WNFEKFLIDKNGNIVNRFPSSTKPESVELKQAIESIL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgactttccatgatttaaaaaccatcaccatccaaggaaaagaaatttcgctcggagaa
tacaaaggccacccagtgcttgtggtcaatgttgcatctaaatgtggttatacgccacaa
tatgaaggattggaaaaactccacttagcatacaaagacaaaggtttgaaagtcgttggt
tttccatccaatgatttcggtggccaagagccaggaacggaagcccaaattgcagaattt
tgtaagctcaattttggtgttagttttgatctaatgaaaaaaaccaaagtgcttggaaat
gacaaggatccagtttaccaatttcttacagagaacgcaaaagaaaaaggggatgtaaaa
tggaactttgaaaagtttctcatcgataaaaatggaaatatagtgaaccgattcccttct
tctaccaaaccagaaagtgtcgaactcaaacaagccattgaaagcatcttataa

DBGET integrated database retrieval system