KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I0951Help
Entry
LEPBI_I0951       CDS       T00693                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LEPBI_I0951 (gmk)
Enzymes [BR:lbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LEPBI_I0951 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:982561..983124
Genome map
AA seq 187 aa AA seqDB search
MKAVPNLYIISSVAGGGKSTIIQALLKENPEFYFSISCTTRDPRPGDEEGKTYYFLTIPE
FQKKIADGEFYEWAEVHGNYYGTPKAPILDAIKEHRVALMDLDVQGAKSVKQLRPESVTI
FIEPPSREIWIERLIRRGTDSKTSIEKRIENGIIELDEAPSFDYVVINDRLEDAITEVKA
ILCGTKS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagctgtcccgaatttatatatcatttcctcggtggctggtggtgggaaatcgacc
atcatccaagcactcttaaaagaaaaccctgagttttatttttcgatctcgtgtacaaca
cgtgacccaaggcctggggatgaggaaggaaaaacatattactttttaaccatacctgaa
ttccaaaaaaaaattgccgatggtgaattttacgaatgggctgaagtccatggcaattat
tacggaacaccaaaggctcccattttagatgccataaaggaacaccgagtggcacttatg
gatttagatgtccaaggagccaaatcagtcaaacaactaaggcctgagtcggttaccatt
tttatcgaaccaccaagccgggaaatttggattgagagactcatcagacgagggacggat
tccaaaacgagtatcgaaaaacggatagaaaatgggatcatcgaattagatgaagcacct
agctttgattatgtggtcataaatgatcgcttagaagatgccattactgaagtaaaggcc
atcctttgtggaaccaaatcataa

DBGET integrated database retrieval system