KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I0961Help
Entry
LEPBI_I0961       CDS       T00693                                 

Definition
putative beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LEPBI_I0961
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LEPBI_I0961
Enzymes [BR:lbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     LEPBI_I0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(993827..995593)
Genome map
AA seq 588 aa AA seqDB search
MNQVLLRTTFSLFLLFGFFGSSYCFGFYLTELAANERKVWLDEKAWSITNAMTEEELVGQ
TIHIAIPSKTVDQIALDEIKQTKPGGIILFGKNLGKKEEILSLTENLQRSAKENGLPPFL
ISTDQEGGRVFRVQDGITHYPGAMAVGQTGKKEWGEIVGFVTSYELRSLGLNFLFAPVLD
INNNPLNPVINTRSFGSDVHRVSDVAVAYERGARAGGCLPVIKHFPGHGDTTVDSHLGLP
IINKSLTELEKLELVPFQESIRGGAEAVMSAHIVYPKIDPNFPATLSKTILTDVLRKSLQ
FDGIIITDAMEMHAISKNYEKDRPGVLTILAGANIVLLTSWGETAKKFKAQLMDAYKNGE
FEFVDKEGKKHDLLKEAVQKQIRKKLELGIYDKNSILPNVYDENQKQKEFLLAWEKERNE
RYKKLSESQNFAKEINEDSIRAYPKSVVTATIVPEQTVSFVKNPRLKEFLKSKKIQSASS
KSFSSFTKQKNFTTYLFDSTSEAEVKMVVGLAKKFPNKRFLVMHGGTPFIQLPELKNLEY
LLSFSLTVGSWEAMGSKLTSGKEIPKVDLILLSKEAKTPSKGAFPESL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagttctccttcgtaccaccttttcccttttccttttattcggattttttgga
tcgtcctattgtttcggattttacctcaccgaacttgccgccaacgaacgaaaggtttgg
ttggatgaaaaagcatggtccatcaccaatgcaatgacagaggaggaactagttggacaa
accatccacatcgccatcccttcgaagacagttgaccaaattgccctcgatgaaatcaaa
caaacaaaacctggtggcatcatcctctttggaaaaaacttagggaaaaaagaagaaatc
ctctctctcacagaaaacctacaacgttccgcaaaagaaaatggcctccccccatttctc
atctccactgaccaagaaggaggacgcgtgtttcgagtccaagatggaatcactcattat
cctggtgccatggctgtgggccaaactggaaaaaaagaatggggtgagattgttgggttt
gtgacttcttatgaattaagaagccttggcctcaattttttatttgcaccagttctcgat
atcaataacaaccctctcaacccagtcattaacacacgttcgtttggatcagatgtccat
cgtgtttctgacgttgccgttgcctatgagcgaggtgcacgggctggtggttgtttgcct
gtgatcaaacatttcccagggcatggagacacaactgtggatagtcacttgggccttccg
atcattaataaaagtttaaccgaattagaaaaactggaactggttccgttccaagagtcc
atccgtggtggcgcggaagctgtgatgtcggctcatatcgtatatccaaaaattgatcct
aatttcccagccacactttccaaaacgattctaacagatgttttacgaaagtcattacag
tttgatggaatcatcattacggatgcgatggagatgcatgccatctctaaaaattatgaa
aaggatcgtccaggagttctcaccatcctcgcaggtgccaatatcgttttactcaccagt
tggggagaaaccgccaaaaagttcaaagcacaactcatggatgcttacaaaaatggggaa
tttgaatttgtggacaaagaaggaaaaaaacacgatctactaaaagaagcagtccaaaaa
caaattcgaaaaaaattagaacttgggatttatgataaaaattccatcctaccgaatgtt
tatgacgaaaaccaaaaacaaaaagaattccttttggcatgggaaaaagaaaggaacgaa
cgatacaaaaaattaagtgagtctcaaaactttgccaaagaaatcaatgaagactccata
cgagcttatccaaaatcagttgtgactgcaaccattgttcccgaacaaacggtttccttt
gtcaaaaacccaagactcaaagagtttttaaaatccaaaaagatccaatctgcctcttct
aaatcattttcaagttttacgaaacaaaagaatttcacaacgtatctgtttgattccacc
tcagaagcagaggtaaaaatggttgttggacttgcaaaaaaattcccaaacaaacgattc
cttgtgatgcacggaggaactcccttcatccaattgccggaacttaagaacttagagtat
ctattgtcattttcgttaactgttggatcttgggaagctatgggttccaaacttacctca
ggaaaagaaatccccaaggtagatttgattttattatcaaaagaagcaaaaacaccatcc
aaaggtgctttccccgaaagtttataa

DBGET integrated database retrieval system