KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I0966Help
Entry
LEPBI_I0966       CDS       T00693                                 

Definition
putative arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LEPBI_I0966
Enzymes [BR:lbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LEPBI_I0966
   3.1.2  Thioester hydrolases
    3.1.2.-  
     LEPBI_I0966
Lipid biosynthesis proteins [BR:lbi01004]
 Fatty acid synthase
  Component type
   LEPBI_I0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1002234..1002896
Genome map
AA seq 220 aa AA seqDB search
MPYFLTFLSLFIALGCGKPSDQTQDPKTQSIESNQTKRILYFGDSLTAGYGLSNYEDAWP
HVLTNRINAEGYFYQMTNAGVSGDTTSGGLGRLEWVLAEKPSIFVLELGANDMLRGISPS
VTKENLRSMIRQIKSLYPNTKILLVGMMATPNMGKKYANAFNSIYPDLAKEENVPLVPFI
LEKVATIRKLNQKDGIHPTDAGHKLVADTVYPYIKPLLEK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgccgtattttttaacctttctttctttattcattgcccttggttgtgggaaaccttcc
gaccaaacacaagatccaaaaactcaatcgatagaatcaaaccaaaccaaacggattttg
tattttggtgattccttgaccgctgggtatggcctaagcaattatgaagatgcttggccc
catgttctcacaaaccgcatcaatgcggaaggttatttttatcaaatgacaaatgcggga
gtatcaggtgatacaacaagtggagggcttggaaggttggaatgggtgcttgcggaaaaa
ccttccatctttgtgctcgagttaggtgccaatgatatgttgcgagggatcagtccttcc
gtcacaaaagaaaacttacgttccatgatccgccaaatcaaatctttatacccaaacacc
aaaatattgttagttggtatgatggccactcccaatatggggaaaaaatatgcgaatgca
ttcaattcaatttatccagatcttgccaaagaagagaatgtccctctagttccctttatc
ttagaaaaagtggccacaattcgaaaactcaatcaaaaggatggaatccatcctacagat
gccggccataaattggtagcggacactgtgtacccttacataaaaccactactagaaaaa
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system