KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I1026Help
Entry
LEPBI_I1026       CDS       T00693                                 

Gene name
pyrB
Definition
(GenBank) Aspartate carbamoyltransferase, catalytic subunit (Aspartate transcarbamylase; ATCase)
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00240  Pyrimidine metabolism
lbi00250  Alanine, aspartate and glutamate metabolism
lbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LEPBI_I1026 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LEPBI_I1026 (pyrB)
Enzymes [BR:lbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LEPBI_I1026 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABZ97149
UniProt: B0SMK5
Position
I:1068303..1069235
Genome map
AA seq 310 aa AA seqDB search
MYAYSHKNILDTLQFSKDDLNYLITKTNRMNALHESGKAFGILHGKLLASLFFEASTRTR
MSFEAAMERLGGRLISTVGFQFSSISKGETLYDTMKMIEAYCDIAVIRHPVEGSSRIAAG
AVNIPVINAGDGAGQHPTQALLDLYTIVSEKGKIDGLNIAFIGDLKYGRTIHSLINLLRH
YPVHLYLISPEELRLPEKYKKNLEGFPMTWEETTDIKAIWDADVAYVTRIQEERFPDHRE
YEKLKDIYKVNKELVLASKKDTTILHPLPRVNELSTDVDDLPNAAYFRQAKYGVVVRMAL
LCLSLGVNFD
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcatactcccataaaaacatcttagacaccttacaattttccaaagacgacctc
aattacctcataacaaaaacaaaccgaatgaatgccttgcatgaatcgggaaaggccttt
ggaatccttcatggaaaactcctggcttccctcttttttgaagccagcacccgcactcgg
atgagttttgaagccgccatggaaaggcttgggggtaggcttatctccacggtcggtttc
cagttttcttccatctccaaaggggaaactttgtatgatacgatgaaaatgatcgaagcc
tattgcgacattgccgtcatccgccacccagtggaaggttcgtctcggattgcagcaggg
gcagtgaacatccccgtgatcaatgcaggtgacggagcaggccaacaccccacacaagct
ctcctcgatttgtatacgattgtttctgaaaaaggaaagatcgatggactgaacattgcc
tttattggggatctgaagtatgggcgaaccattcattctctcatcaatctcctcagacat
tacccagtgcatttgtatctcattagtcccgaagagctaagactccccgaaaagtacaaa
aagaacttagaaggatttccaatgacatgggaggaaaccactgacatcaaagcaatttgg
gatgcggatgttgcctatgtcacaaggatccaagaagaaaggttccctgaccacagggag
tatgaaaaactaaaagatatttataaggtgaataaggaactggtccttgcttccaaaaaa
gacacaaccatcctccacccactgccacgcgtgaacgaactatccactgatgtggatgat
ttgcctaatgcagcttactttcgtcaggcgaagtatggcgttgtggtgcgaatggcatta
ctttgtctgagccttggagtgaattttgactaa

DBGET integrated database retrieval system