KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I1103Help
Entry
LEPBI_I1103       CDS       T00693                                 

Definition
putative metallo-dependent phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lbi00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:lbi00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:lbi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1148100..1149188
Genome map
AA seq 362 aa AA seqDB search
MQMITKSQILFPIFVFLIFISQKPIFAKDSNSLSIGFGSCLHQDKESPILNTILGKKLEY
LILLGDIVYADSLIADEKIPAFEKQFNRKEWKSIQKNTQLLFTWDDHDYGLNDSGGEYPD
KVKSRNLFLSYVKPRMPKKITFGTKNKEGVFYSYWVLFHGKKIHIVVPDTRYFRSPLQRS
FLSYFTGKSHYKPSNETNQNLLGDEQWIWLEEELSKPSDLLVFVSSIQVLPTEQPFEKWN
NLPNEREKLIQSLYKANTKDMVILSGDRHLAEIHEYKNMNHPRLVEITSSSFNLPLPWLP
LEYDSELKLGKAYKNENFGILQIFWNDGKLHWKSTIHDKEGNSVLEYDPSQETVSNQSKG
IE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttgcagatgataacaaaaagccaaatcctatttcctatttttgtgtttttgattttcata
agtcaaaaaccaatttttgctaaagattcaaattcgctttcgattggatttggttcctgt
ttacaccaggataaagaaagtcccatcttaaacacaatccttggaaaaaaattagagtat
ctgattttacttggagacattgtatatgcggatagtttgattgcggatgaaaaaattcct
gcatttgaaaaacaattcaatcggaaagaatggaaatctatacaaaagaacactcaatta
ttattcacttgggatgaccatgactacggtttgaatgatagtggtggtgaatatccagac
aaagtgaaatcccgaaatctatttttatcttatgtgaaaccacgcatgcccaaaaaaatt
accttcggaaccaaaaacaaggaaggagtattttattcatattgggttttatttcatgga
aaaaagatacacattgttgtacctgatacacgctattttcgttcccctttgcagaggagt
tttctttcttacttcactggcaaaagccattataaaccatcaaatgaaacgaaccaaaac
cttcttggtgatgaacagtggatttggttagaagaagagttgtccaaaccttctgacttg
ctggtctttgtttccagtatccaggtgttaccgacagaacaaccatttgagaaatggaat
aatttgccaaatgaaagagaaaaattgattcaatcattatacaaagcaaatacgaaggat
atggtgattctttctggggatcgccatcttgctgaaattcatgaatataaaaatatgaat
catccaaggttagttgaaatcacatcgagttcctttaatttgccacttccttggttgcct
ttagaatatgattctgagttaaagttaggtaaggcctacaaaaatgaaaattttggaatc
ctccaaatattttggaacgatgggaaattacattggaaatctaccattcatgataaagaa
gggaattctgttttggaatatgacccttcccaagaaacagtttccaatcaatcaaaggga
atcgaatag

DBGET integrated database retrieval system