KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I1103Help
Entry
LEPBI_I1103       CDS       T00693                                 

Definition
putative metallo-dependent phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LEPBI_I1103
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LEPBI_I1103
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LEPBI_I1103
Enzymes [BR:lbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LEPBI_I1103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1148100..1149188
Genome map
AA seq 362 aa AA seqDB search
MQMITKSQILFPIFVFLIFISQKPIFAKDSNSLSIGFGSCLHQDKESPILNTILGKKLEY
LILLGDIVYADSLIADEKIPAFEKQFNRKEWKSIQKNTQLLFTWDDHDYGLNDSGGEYPD
KVKSRNLFLSYVKPRMPKKITFGTKNKEGVFYSYWVLFHGKKIHIVVPDTRYFRSPLQRS
FLSYFTGKSHYKPSNETNQNLLGDEQWIWLEEELSKPSDLLVFVSSIQVLPTEQPFEKWN
NLPNEREKLIQSLYKANTKDMVILSGDRHLAEIHEYKNMNHPRLVEITSSSFNLPLPWLP
LEYDSELKLGKAYKNENFGILQIFWNDGKLHWKSTIHDKEGNSVLEYDPSQETVSNQSKG
IE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ttgcagatgataacaaaaagccaaatcctatttcctatttttgtgtttttgattttcata
agtcaaaaaccaatttttgctaaagattcaaattcgctttcgattggatttggttcctgt
ttacaccaggataaagaaagtcccatcttaaacacaatccttggaaaaaaattagagtat
ctgattttacttggagacattgtatatgcggatagtttgattgcggatgaaaaaattcct
gcatttgaaaaacaattcaatcggaaagaatggaaatctatacaaaagaacactcaatta
ttattcacttgggatgaccatgactacggtttgaatgatagtggtggtgaatatccagac
aaagtgaaatcccgaaatctatttttatcttatgtgaaaccacgcatgcccaaaaaaatt
accttcggaaccaaaaacaaggaaggagtattttattcatattgggttttatttcatgga
aaaaagatacacattgttgtacctgatacacgctattttcgttcccctttgcagaggagt
tttctttcttacttcactggcaaaagccattataaaccatcaaatgaaacgaaccaaaac
cttcttggtgatgaacagtggatttggttagaagaagagttgtccaaaccttctgacttg
ctggtctttgtttccagtatccaggtgttaccgacagaacaaccatttgagaaatggaat
aatttgccaaatgaaagagaaaaattgattcaatcattatacaaagcaaatacgaaggat
atggtgattctttctggggatcgccatcttgctgaaattcatgaatataaaaatatgaat
catccaaggttagttgaaatcacatcgagttcctttaatttgccacttccttggttgcct
ttagaatatgattctgagttaaagttaggtaaggcctacaaaaatgaaaattttggaatc
ctccaaatattttggaacgatgggaaattacattggaaatctaccattcatgataaagaa
gggaattctgttttggaatatgacccttcccaagaaacagtttccaatcaatcaaaggga
atcgaatag

DBGET integrated database retrieval system