KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I1169Help
Entry
LEPBI_I1169       CDS       T00693                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LEPBI_I1169 (hemB)
Enzymes [BR:lbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     LEPBI_I1169 (hemB)
Exosome [BR:lbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LEPBI_I1169 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1217903..1218856)
Genome map
AA seq 317 aa AA seqDB search
MKKQTLRLRSHKSLRHLSESGSLNVNKMIQPLFLVEGLTEKEPIKGLPDVYRDTNQTIFK
QIESDLKSGVSQFLLFMVPNEKSDTSFSKEFYHSNISAIKKTFPEMFLWLDTCICSVTTS
GHCCHFHPKGNIDLKLTLNRLSELALIYADAGADGIAPSDMMDGRVASHRKILDENNHSH
VPIMSYSTKFKSHFYGPFRGAADSSPQFGDRSGYQLDVRDRETAIQTSIRDKEEGADLLM
VKPGMTSIDLIGPIKDKTGLPTGAYQVSGEYASLVYLAKEGFLNFEDGLRETWDVFRRAG
SSFLITYGARIAQRLYS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacaaacacttcgattacgttcccacaagtcactccgtcatctgagcgaatca
ggttccttaaatgtgaacaaaatgatccaacctttattccttgtggaaggtcttaccgaa
aaagaaccgatcaaagggttaccagatgtttaccgcgatacgaaccaaaccatcttcaaa
caaattgagtctgatttaaaatcaggtgtctcgcagtttttgctatttatggttccaaac
gaaaaatcggacaccagtttttcaaaagagttttaccattcaaatattagtgccataaaa
aaaacattccctgaaatgtttttatggttagatacttgtatctgctcagtgacaacatcc
ggacattgttgccacttccatcctaaaggtaacattgatttaaaattaacattaaatcga
ttgtctgaactagcattgatttatgcagatgcgggtgctgacggtattgcacctagtgat
atgatggatggaagggttgcatcacatagaaagattctcgatgaaaacaaccattcccat
gttcccatcatgagttattctacaaaattcaaaagtcatttttacggtcccttccgtggt
gctgccgactcctcaccgcagtttggtgatagaagtggataccaattggatgttagagac
agagaaactgcaatccaaacttccattcgagacaaagaagaaggtgcggatttattaatg
gtaaaaccagggatgacttctattgatttgattggtcctatcaaagataaaacaggactc
cctactggtgcttaccaagtgagtggcgagtatgcaagtctcgtttacttagcaaaagaa
ggttttctcaattttgaagatggtttaagagaaacatgggacgtgtttcgcagagccgga
tcttcatttttaatcacgtatggtgcaaggattgcacaaaggttgtattcatga

DBGET integrated database retrieval system