KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I1308Help
Entry
LEPBI_I1308       CDS       T00693                                 

Definition
putative acireductone dioxygenase, ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:lbi00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1362970..1363509
Genome map
AA seq 179 aa AA seqDB search
MEMATIVKKQETIQDKDQVKAYLTQKGLVYESYKTPESLDLILGQKGLSDAEKEEVLSGL
EYRFDQLKKQHGYKANDLVVLHDEVPGISDMLAKFDKLHIHTDEEVRYIIDGSGIFGFII
DGERFEVHVGKGDFISIPANTNHWFTLDQTMRIKAVRYFKDNSGWTPVYVDESKVLINA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggcaacgatagtcaaaaaacaagaaacgatccaggacaaagaccaagtgaaa
gcatacctgacccaaaaagggcttgtgtatgaatcttacaaaactcctgaatctttggat
ttgatcctcggccaaaaaggtttatccgatgcggaaaaagaagaagtcctttctggtctg
gaataccgatttgaccaattgaaaaaacaacatggctacaaagcaaacgaccttgtggtc
cttcatgacgaagtgccagggatcagtgacatgttagctaaatttgacaaacttcacatc
catacagatgaagaagttcgttacatcattgatgggagtgggatttttggcttcatcatt
gacggagaacgatttgaagtccatgttgggaaaggtgattttatctccatccctgccaat
acaaaccactggttcacattggaccaaacaatgcggatcaaagccgttcgatactttaag
gacaactcaggttggacacccgtttatgtggatgaatcgaaagtcctcatcaatgcataa

DBGET integrated database retrieval system