KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I1323Help
Entry
LEPBI_I1323       CDS       T00693                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lbi00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1378369..1379865
Genome map
AA seq 498 aa AA seqDB search
MAKKNYIIGIDAGTTGIRTFCFNDKGKVISSAYQEFKQYYPKPGWVEHDPEEIWVKTQKL
ITLAIKNGKLNPKDAVAIGITNQRETSVVWDKKTGKPVYNAIVWQCRRTSDICKDLKKQS
LDSNFRNKTGLVLDAYFSGTKIQWILDNVKGARDRAERGDLLFGTIDTWLLYKLTGHKEH
KTDHTNASRTLLFNIQTKEWDEELCKILRVPMSMLPKAFNSKNLFGFTSNVKSIPDGIPI
SSLVGDQQGALFGQLCTEPGEAKNTYGTGCFLLFNVGDEFRISNQGLITTLALGPEGKTV
YCLEGSVFIGGAVVQFLRDNLEFFKYSKDSEKLVKSIKTKDDIVFVPAFAGLGAPHWDQE
ARGAIFGLSRDTTPAQITRAALKAIALQSYELANAMEKETGKPLKFLRVDGGATSNAWLM
QFQADILGTKVIRPQNVDTTVLGAAYLAGLERGFFKSVAHLRKEETKTTQFTPKMKESER
KEEIDKWNLAISRVKTET
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaaaattacatcattggaattgatgcaggtacaactgggattcgtacattt
tgttttaatgacaaagggaaagtgatctcctcggcttaccaagagttcaaacaatactat
ccaaaaccaggttgggtggaacatgacccagaagagatttgggtaaaaacacaaaagctc
atcacacttgccattaaaaatggaaagttaaatcccaaagatgccgtggccattgggatc
acaaaccaaagggaaacttcggttgtttgggataaaaaaacaggaaaacctgtttataat
gccatcgtttggcaatgccgacgtacttctgatatttgtaaggacttaaaaaaacaaagc
ctagattccaattttcgaaataaaacagggctagtcctagatgcttatttttcaggtacc
aaaatccaatggatcttagacaatgtgaaaggggcaagggatcgggcagaacgtggtgac
cttctttttggaaccattgatacctggttattgtacaaactcacaggccataaagaacat
aaaaccgatcataccaatgcatctcgaaccttactttttaatatccaaaccaaagaatgg
gatgaagaactatgtaagattttaagagttcccatgtccatgttaccgaaggcatttaac
tccaaaaatctctttgggtttacttctaatgtcaaatccatcccagatggaatcccaatt
tcttcgttagttggtgaccaacaaggggcactctttggacaactttgtacagaaccaggg
gaagccaaaaatacctatggaacgggttgttttttactattcaatgtgggggatgaattc
cggatttcgaaccaaggtctcatcaccacattggccctcggtccagaagggaaaactgtg
tactgtttggaaggatctgtttttatcgggggtgctgtggtccaattcctccgagacaat
ttggaattttttaaatactcaaaagactcggaaaaactcgtgaagtcgatcaaaacaaaa
gatgatattgtgtttgttcctgcctttgcaggtcttggtgccccgcattgggaccaagaa
gcacgtggtgccatctttggactctctcgtgacacaacgcctgcccaaatcacaagagcc
gctctcaaagccattgccttacaatcctatgaacttgccaatgcaatggaaaaggaaacg
ggaaaaccattgaaatttttacgagtggatggtggtgccacttccaacgcatggctcatg
caattccaagctgacatcttaggaacaaaagtgatccgaccacaaaacgtggatacgacg
gtgctgggtgcggcatacttggcaggactcgaacgtggattttttaaatcagtggctcac
cttcgaaaagaagaaaccaaaaccacacaattcacaccgaagatgaaagaatccgaacgg
aaagaagaaattgataagtggaatttagccatttctcgtgtgaaaacggaaacctaa

DBGET integrated database retrieval system