KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I1382Help
Entry
LEPBI_I1382       CDS       T00693                                 

Gene name
fadB1
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LEPBI_I1382 (fadB1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LEPBI_I1382 (fadB1)
   00650 Butanoate metabolism
    LEPBI_I1382 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    LEPBI_I1382 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LEPBI_I1382 (fadB1)
   00310 Lysine degradation
    LEPBI_I1382 (fadB1)
   00360 Phenylalanine metabolism
    LEPBI_I1382 (fadB1)
   00380 Tryptophan metabolism
    LEPBI_I1382 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LEPBI_I1382 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LEPBI_I1382 (fadB1)
   00281 Geraniol degradation
    LEPBI_I1382 (fadB1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LEPBI_I1382 (fadB1)
   00627 Aminobenzoate degradation
    LEPBI_I1382 (fadB1)
   00930 Caprolactam degradation
    LEPBI_I1382 (fadB1)
Enzymes [BR:lbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LEPBI_I1382 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1438974..1439807)
Genome map
AA seq 277 aa AA seqDB search
MNPSPFFTIERRKNVAILWLNRPEKRNAMNWPFWRDLPDMVAEIDADPKIHAFVIAGKGK
SFSTGLDLEEFFQDFKPVVQGEFADGREKLYQLILTMQKGINAVYNSKKPSIALVQKHCI
GGGLDLVSACDIRYASDDAVFSLRESKVAIVADMGSLQRLPHLIGNAHTRELALTGKDVT
ANEAFQMGLVTKVTKDFDSLLVEGLKTANEIAENPTIVIRGVKQVLNHGVGKTIEEGLDY
VAVWNASMLDSKDFRSAIGGFMERKRPVFNPETRVDD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatctccattttttaccatcgaaagaagaaaaaacgtcgccatcctttggttg
aatcgtcctgaaaaacgaaatgccatgaactggcctttttggcgtgaccttccggatatg
gtggcagagattgatgctgatccgaaaatccatgcatttgtgatcgcaggcaaaggaaaa
tctttttcgacaggacttgatttggaggaatttttccaagacttcaaacccgtcgtccaa
ggggaattcgcagatggtcgagaaaaactttaccaactcattctcacgatgcaaaaagga
atcaacgctgtttacaattccaaaaaaccatcgattgcactagttcaaaaacattgtatc
ggtggaggactggatttggtatcagcctgtgacattcggtatgcatctgacgacgctgta
ttttccttacgtgaatccaaagtcgccatcgttgccgacatgggatccttacaaagactc
ccccatttgattggaaatgcacatacaagagagcttgccctcacgggaaaagacgttacg
gcaaatgaagcctttcaaatgggacttgtgacaaaggtcacaaaagactttgattcttta
ttggtagaaggtctcaaaacggcgaatgaaatagctgaaaatccaacaattgtaatccga
ggcgtcaaacaagtgctaaatcatggagtaggaaaaaccattgaagaaggtttggactac
gtggcggtttggaatgcaagtatgctcgattccaaagatttccgaagtgccatcggtggg
tttatggaacgaaaacgacctgtcttcaatccagaaacccgagtggacgattga

DBGET integrated database retrieval system