KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I1425Help
Entry
LEPBI_I1425       CDS       T00693                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LEPBI_I1425 (malQ)
Enzymes [BR:lbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     LEPBI_I1425 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1487530..1489251
Genome map
AA seq 573 aa AA seqDB search
MGSLIRVKQRRAGVLVSLPSIVSEHSFECGDIYSLYPLCDWAKDVGFSIIQLLPLNDTGF
GYSPYSAISAFAIDPLYISLYKMGQTTRSRKKEIKTLHNHPNRIRNEKIKIIRAHYESHQ
KEAQKEALQFLETQTWCYSYVTFRVLYETFEGKNWWEWPSEFQNLSSAKDYIFNEKREEA
LFWVYLQKIAYDQLCGVKLYCEDVGIFLKGDMPILTSRNSCDVWEHPDYFIMDLQAGAPP
DQFSATGQNWGFPVLNWDALEKNHYRWWKDRLTYLEHFFHLYRIDHVIGMYRIWAIPKED
KTAQKGWFHPQFGIETSEFLNVGINPKSMEEKGLIHEFKPNHYIFYWDFWKEESYQSLPE
ETKAKLFPLSQLHITAEEKHWREAGEKILEIFDSFSSMVPCAEDLGSVPSFIRDSLFERQ
MIGIDVVRWTKSFTTGEFIEEDNYRDNAISVLSTHDTSLVMDWWKHEGDLESKLQFFFDR
VGKPRPETEDQILEGLLEFVFQTKSIFSIQLFQDLALGISDVVENPEKHRINLPGTPDHS
NWTYRFPILIEEFANNFQRNFTIRKLVHSSGRI
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
ttgggatctttgattcgtgtcaaacaaagaagggcaggggtacttgtatctctgccctca
attgtttcagagcattcctttgaatgtggggacatttatagtttatacccactctgcgat
tgggcaaaagacgttggctttagcatcatccaattattaccattaaacgatacaggattc
ggatactcaccctatagtgccatctctgcttttgcgatcgaccctctttacatttcctta
tacaaaatgggacaaacgaccaggtctcgtaaaaaggaaatcaaaacattacacaaccat
ccgaatcgcattcgaaatgaaaaaatcaaaatcattcgtgcccattatgaatcgcatcaa
aaggaagctcaaaaagaagcattacaatttttagaaacacaaacttggtgttattcctat
gtgaccttccgcgttttgtatgaaacgtttgaaggtaaaaattggtgggaatggccaagt
gagtttcaaaacctttcctctgcaaaagattatatctttaatgaaaaaagagaggaagct
ctcttttgggtatacctacaaaaaatcgcctatgatcagttatgtggggtaaagttgtat
tgtgaagatgtgggaatatttttgaaaggggatatgccgattctcacctcccggaattct
tgtgatgtttgggaacacccggattactttatcatggacttacaggcgggtgcccctcca
gatcaattttctgccacaggacaaaactgggggtttcctgttctcaattgggatgcgtta
gaaaagaaccattaccgttggtggaaggataggcttacctatttagaacattttttccat
ctctatcgcattgaccatgtgattgggatgtatcggatttgggcgattccaaaggaagat
aaaacagcgcagaaaggttggttccatcctcaattcggaattgaaacgagtgaattttta
aatgtaggaatcaatccgaagtccatggaagagaagggcctcatccatgagttcaaaccc
aatcattatattttctattgggatttttggaaagaggaaagttatcagtcccttcctgaa
gaaaccaaggcaaaattattccctctctcccaattgcatatcacagcagaagaaaaacat
tggcgggaagcgggcgaaaaaatcttagaaatttttgattcgttttcatcgatggtgcct
tgtgcggaggatttgggttctgtgcccagtttcattcgtgattctttgtttgaaaggcaa
atgattggcattgatgtagtgcgttggaccaaatcctttaccactggggaattcatcgaa
gaggacaattatagggataatgcgatctctgttttatcgacacatgacacaagtttggtg
atggattggtggaaacacgaaggggacttggaatccaaacttcagtttttctttgacaga
gttggaaaaccaagacccgaaacagaagaccaaattttagaagggttactcgaatttgta
ttccaaaccaaaagtatctttagcatccaactctttcaggatttggcgctcggaatatcg
gatgtcgtcgagaatccagaaaaacaccgcatcaatttgcctggaacccctgaccattcc
aattggacctaccggtttcctatcctcatcgaagagtttgcaaacaacttccaaaggaat
tttactatacggaaactcgtccattcttcaggtagaatttag

DBGET integrated database retrieval system