KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I1557Help
Entry
LEPBI_I1557       CDS       T00693                                 

Gene name
acoC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00010  Glycolysis / Gluconeogenesis
lbi00020  Citrate cycle (TCA cycle)
lbi00620  Pyruvate metabolism
lbi01100  Metabolic pathways
lbi01110  Biosynthesis of secondary metabolites
lbi01120  Microbial metabolism in diverse environments
lbi01130  Biosynthesis of antibiotics
lbi01200  Carbon metabolism
Module
lbi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEPBI_I1557 (acoC)
   00020 Citrate cycle (TCA cycle)
    LEPBI_I1557 (acoC)
   00620 Pyruvate metabolism
    LEPBI_I1557 (acoC)
Enzymes [BR:lbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LEPBI_I1557 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 peroxidase LMP
Motif
Other DBs
NCBI-ProteinID: ABZ97664
UniProt: B0SQK6
Position
I:complement(1624148..1625542)
Genome map
AA seq 464 aa AA seqDB search
MMAKIQEMTQLSPTMEEGTIVKWLKNEGDAISPGDILAEVETDKAVMEMEAYDAGVILKI
IQQEGTKLRVGEAMAIIGKPGEDISSLLSNLPKKETQAKGPNPTSPSPSGEVSSESGANG
NDRAITQEKAIQEKQTLETPTEAQFPVAQGSAIPTKNSSSSQKPLPLSNIPRGSLRVLAS
PLAKSIAIEHGIDLHQVLGTGPEGRITKKDVLDSLNKGFRPSSFDSDKMSQDEVVSLNGM
RKTIAKRLTESKQNLPHFYLNVDINAKALESFRKEINDFQTSQNPDSANKVSLNDIIVKA
TAAALKLHPKVNASFQGDSILQFGRVDVGIAVSIDGGLLTPVIRDANRKSILEISKEVKE
LAKKARDRKLKPEEFTNGTFTISNLGMYGISRFTAIINEPEGAILAVGSAEDKPVVENGV
VVAGRVISLTLSCDHRVIDGAVGAEFLKTLRSFLEKPNLLLAVG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaaatccaagaaatgacccaattatctcctaccatggaagaaggaaccatt
gttaagtggttgaaaaatgaaggggacgcaatcagtccaggtgacatcctagcagaagtc
gaaaccgataaagctgtgatggagatggaagcctatgatgcaggtgtgatccttaaaatc
atccaacaggaaggcaccaaactgagagttggtgaagccatggcaatcattggaaaacct
ggagaagacatctcctccctcctttccaatcttccgaaaaaagaaacgcaggcaaaaggc
ccaaatcccactagtccctccccatccggggaagtaagttccgaatcgggagctaatgga
aatgatcgagctatcacccaagaaaaagccatacaagaaaaacaaaccctagaaacacct
accgaagcccaatttccagtggctcaaggatcagccattcctacaaagaattcaagttcg
tcgcaaaaacctctgcctctttccaacattccaagaggatccctccgtgtacttgcctct
cctcttgccaaatccatcgccatcgaacatggaatcgatttgcaccaagttttgggaact
ggcccggaaggtaggatcaccaaaaaagatgttctggattccttaaacaaaggttttcgt
ccatcgagttttgattctgacaagatgagccaagatgaagtggtcagtttgaatggaatg
cggaaaaccattgccaaacgactcacagaatccaaacagaacctcccccatttttatttg
aatgtggatataaatgccaaagcactggagtccttccgaaaggaaattaacgacttccaa
acctcacaaaatccagattcggcaaataaggtgagtttgaatgacatcattgtcaaagca
accgcggccgcactcaaactccacccaaaagtcaatgcgagtttccaaggagattctatc
ttacaatttgggagagtggatgtagggattgctgtctccattgatggcggtctattaacg
cctgtcattcgagatgcgaatcgaaagtccatcttagaaatttcaaaagaagtgaaggaa
ctcgccaaaaaagcaagggatcgaaagttaaaaccggaagaatttaccaatggaaccttt
accatttccaatttagggatgtatgggatcagtcggtttacggcgatcatcaacgaaccg
gaaggagccatcctggctgtaggttctgcagaagacaaaccggttgtggaaaacggagtt
gtggtagcgggaagggtaatttccctcacactctcctgcgatcatcgtgtgatcgatgga
gctgtgggagcagagtttctaaagaccttaaggagctttttggaaaaaccaaacctactc
cttgcagtcggttaa

DBGET integrated database retrieval system