KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I2056Help
Entry
LEPBI_I2056       CDS       T00693                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LEPBI_I2056 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LEPBI_I2056 (sucC)
   00640 Propanoate metabolism
    LEPBI_I2056 (sucC)
   00660 C5-Branched dibasic acid metabolism
    LEPBI_I2056 (sucC)
Enzymes [BR:lbi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LEPBI_I2056 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2144575..2145786
Genome map
AA seq 403 aa AA seqDB search
MAKAYGRTNDIRKSMKVHEYQAKEILRRHNANVPFGKVIDAVGDFEKAYNEVVQKSPVVV
VKAQIHAGGRGKGGGVKVAKTKDDAKAAAEKILGMQLITPQTGPEGKKVLKVYLEQGLEI
AKEYYLSILLDRAIRKTIIMASTEGGMEIEEVAETHPEKIIKIQIDPGIGIQGSQVRELA
FALGIPTEAQKSFTALVNSVYNAYIKEDAALLEINPLILTKQNEIIAGDCKMDLDENALY
RHPDNEALRDITEEDPYEVKAKEYNLNYVKLDGNIGCMVNGAGLAMATMDIVKLAGAEPA
NFLDVGGGANPTTVENGFRLILSDPNVKGIFVNVFGGIVRCDRVAVGIIEATKKVNVSVP
VVVRLKGTNAEEGKKILNESGMNIVGVEGLRDAADKIVSLIKK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaaggcctacggacgtaccaatgacataaggaaatccatgaaagtccacgaatac
caggccaaagaaatcctacgtagacacaatgccaacgttccgttcggaaaggtcatcgac
gctgtcggtgatttcgaaaaggcatataacgaagttgtccaaaaatcaccagttgttgtg
gtgaaagcccaaatccacgcaggtggacgcggaaaaggtggcggtgtgaaagtcgccaaa
acaaaagacgatgcaaaagcggccgcagaaaaaattctcgggatgcaactcatcactccg
caaacaggaccagaagggaaaaaagtcctcaaagtctatttagaacaaggacttgaaatt
gcaaaggaatactacctttctatccttcttgaccgtgccattcgtaaaaccatcatcatg
gcttccacagaaggtgggatggaaattgaagaagtggcagaaacccaccctgaaaaaatc
atcaaaatccaaattgatccaggaattggtatccaaggatctcaagtgagagaacttgcg
tttgctctcgggattccaacagaagcacaaaaatccttcacggctcttgtgaactcagtt
tacaacgcctacatcaaagaagatgcagccctacttgagatcaaccccctcatcctcacc
aaacaaaacgaaatcatcgcaggggactgcaagatggacttggatgaaaacgcactttac
cgtcatccagacaacgaagcacttcgagatattacagaagaagatccatacgaagtcaaa
gccaaagaatacaacctcaactatgttaagttagatggaaacatcggttgtatggtcaac
ggtgcaggtcttgccatggcaaccatggacatcgttaagttagctggtgctgaacctgca
aactttttggatgttggaggtggagcaaacccaacaaccgtggaaaatggtttcagactc
attctttctgatccaaacgtaaaaggaatttttgtgaacgtatttggtggaatcgtacga
tgtgaccgcgttgcggttggtatcatcgaagcgaccaaaaaagtgaacgtatccgttcca
gttgtggttcgtttgaaaggaacgaacgcagaagaagggaaaaaaatcctgaacgaatct
gggatgaacattgtgggagtcgaagggctccgtgacgcggcagacaaaattgtctcccta
atcaaaaaatag

DBGET integrated database retrieval system