KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I2056Help
Entry
LEPBI_I2056       CDS       T00693                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LEPBI_I2056 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LEPBI_I2056 (sucC)
   00640 Propanoate metabolism
    LEPBI_I2056 (sucC)
   00660 C5-Branched dibasic acid metabolism
    LEPBI_I2056 (sucC)
Enzymes [BR:lbi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LEPBI_I2056 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2144575..2145786
Genome map
AA seq 403 aa AA seqDB search
MAKAYGRTNDIRKSMKVHEYQAKEILRRHNANVPFGKVIDAVGDFEKAYNEVVQKSPVVV
VKAQIHAGGRGKGGGVKVAKTKDDAKAAAEKILGMQLITPQTGPEGKKVLKVYLEQGLEI
AKEYYLSILLDRAIRKTIIMASTEGGMEIEEVAETHPEKIIKIQIDPGIGIQGSQVRELA
FALGIPTEAQKSFTALVNSVYNAYIKEDAALLEINPLILTKQNEIIAGDCKMDLDENALY
RHPDNEALRDITEEDPYEVKAKEYNLNYVKLDGNIGCMVNGAGLAMATMDIVKLAGAEPA
NFLDVGGGANPTTVENGFRLILSDPNVKGIFVNVFGGIVRCDRVAVGIIEATKKVNVSVP
VVVRLKGTNAEEGKKILNESGMNIVGVEGLRDAADKIVSLIKK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaaggcctacggacgtaccaatgacataaggaaatccatgaaagtccacgaatac
caggccaaagaaatcctacgtagacacaatgccaacgttccgttcggaaaggtcatcgac
gctgtcggtgatttcgaaaaggcatataacgaagttgtccaaaaatcaccagttgttgtg
gtgaaagcccaaatccacgcaggtggacgcggaaaaggtggcggtgtgaaagtcgccaaa
acaaaagacgatgcaaaagcggccgcagaaaaaattctcgggatgcaactcatcactccg
caaacaggaccagaagggaaaaaagtcctcaaagtctatttagaacaaggacttgaaatt
gcaaaggaatactacctttctatccttcttgaccgtgccattcgtaaaaccatcatcatg
gcttccacagaaggtgggatggaaattgaagaagtggcagaaacccaccctgaaaaaatc
atcaaaatccaaattgatccaggaattggtatccaaggatctcaagtgagagaacttgcg
tttgctctcgggattccaacagaagcacaaaaatccttcacggctcttgtgaactcagtt
tacaacgcctacatcaaagaagatgcagccctacttgagatcaaccccctcatcctcacc
aaacaaaacgaaatcatcgcaggggactgcaagatggacttggatgaaaacgcactttac
cgtcatccagacaacgaagcacttcgagatattacagaagaagatccatacgaagtcaaa
gccaaagaatacaacctcaactatgttaagttagatggaaacatcggttgtatggtcaac
ggtgcaggtcttgccatggcaaccatggacatcgttaagttagctggtgctgaacctgca
aactttttggatgttggaggtggagcaaacccaacaaccgtggaaaatggtttcagactc
attctttctgatccaaacgtaaaaggaatttttgtgaacgtatttggtggaatcgtacga
tgtgaccgcgttgcggttggtatcatcgaagcgaccaaaaaagtgaacgtatccgttcca
gttgtggttcgtttgaaaggaacgaacgcagaagaagggaaaaaaatcctgaacgaatct
gggatgaacattgtgggagtcgaagggctccgtgacgcggcagacaaaattgtctcccta
atcaaaaaatag

DBGET integrated database retrieval system