KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I2056Help
Entry
LEPBI_I2056       CDS       T00693                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:lbi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lbi00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lbi00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:lbi00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2144575..2145786
Genome map
AA seq 403 aa AA seqDB search
MAKAYGRTNDIRKSMKVHEYQAKEILRRHNANVPFGKVIDAVGDFEKAYNEVVQKSPVVV
VKAQIHAGGRGKGGGVKVAKTKDDAKAAAEKILGMQLITPQTGPEGKKVLKVYLEQGLEI
AKEYYLSILLDRAIRKTIIMASTEGGMEIEEVAETHPEKIIKIQIDPGIGIQGSQVRELA
FALGIPTEAQKSFTALVNSVYNAYIKEDAALLEINPLILTKQNEIIAGDCKMDLDENALY
RHPDNEALRDITEEDPYEVKAKEYNLNYVKLDGNIGCMVNGAGLAMATMDIVKLAGAEPA
NFLDVGGGANPTTVENGFRLILSDPNVKGIFVNVFGGIVRCDRVAVGIIEATKKVNVSVP
VVVRLKGTNAEEGKKILNESGMNIVGVEGLRDAADKIVSLIKK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaaggcctacggacgtaccaatgacataaggaaatccatgaaagtccacgaatac
caggccaaagaaatcctacgtagacacaatgccaacgttccgttcggaaaggtcatcgac
gctgtcggtgatttcgaaaaggcatataacgaagttgtccaaaaatcaccagttgttgtg
gtgaaagcccaaatccacgcaggtggacgcggaaaaggtggcggtgtgaaagtcgccaaa
acaaaagacgatgcaaaagcggccgcagaaaaaattctcgggatgcaactcatcactccg
caaacaggaccagaagggaaaaaagtcctcaaagtctatttagaacaaggacttgaaatt
gcaaaggaatactacctttctatccttcttgaccgtgccattcgtaaaaccatcatcatg
gcttccacagaaggtgggatggaaattgaagaagtggcagaaacccaccctgaaaaaatc
atcaaaatccaaattgatccaggaattggtatccaaggatctcaagtgagagaacttgcg
tttgctctcgggattccaacagaagcacaaaaatccttcacggctcttgtgaactcagtt
tacaacgcctacatcaaagaagatgcagccctacttgagatcaaccccctcatcctcacc
aaacaaaacgaaatcatcgcaggggactgcaagatggacttggatgaaaacgcactttac
cgtcatccagacaacgaagcacttcgagatattacagaagaagatccatacgaagtcaaa
gccaaagaatacaacctcaactatgttaagttagatggaaacatcggttgtatggtcaac
ggtgcaggtcttgccatggcaaccatggacatcgttaagttagctggtgctgaacctgca
aactttttggatgttggaggtggagcaaacccaacaaccgtggaaaatggtttcagactc
attctttctgatccaaacgtaaaaggaatttttgtgaacgtatttggtggaatcgtacga
tgtgaccgcgttgcggttggtatcatcgaagcgaccaaaaaagtgaacgtatccgttcca
gttgtggttcgtttgaaaggaacgaacgcagaagaagggaaaaaaatcctgaacgaatct
gggatgaacattgtgggagtcgaagggctccgtgacgcggcagacaaaattgtctcccta
atcaaaaaatag

DBGET integrated database retrieval system