KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I2082Help
Entry
LEPBI_I2082       CDS       T00693                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:lbi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lbi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lbi00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lbi00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:lbi00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2177053..2177802
Genome map
AA seq 249 aa AA seqDB search
MRKKIIAGNWKMNLTLAEAKEITKGLLSACDSSSYEIMVFPSALHLESVASIARDSQLIV
GAQNAYQSGLTAMTGEISPVQLAELGIQTVLVGHSERRQFLGETSEFDNTKISYFLKHGL
RVVYCVGETWAEREKGNTFSVLEDQIGKGLKGITSDLFKNLVIAYEPVWAIGTGKVATPV
EAEEAHAFIRKEIGKLFVGADLVAENIQILYGGSVKPDNIKELLAKPNIDGGLVGGASQK
LDLFLGLLK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagaagatcatcgcagggaattggaaaatgaacctcacgctagcggaggcaaaa
gaaatcaccaaaggtttactctcggcttgtgactcttcttcttatgaaatcatggtcttc
ccgagtgccctccatttggagtcagtggcatccattgcccgagactcccaactcatcgtg
ggggcacaaaatgcctaccaatcggggcttaccgccatgacaggtgaaatctccccagtc
cagctggcagaactgggcatccaaaccgttcttgtgggccactcggaaaggagacaattc
ctcggagaaacatccgaatttgacaataccaaaatctcctacttcttaaaacatggacta
cgagttgtctattgtgtcggggaaacttgggccgaacgagaaaaaggaaacaccttttct
gtgttagaggaccaaattggcaaaggattaaaagggatcacaagtgaccttttcaaaaac
ctcgtgattgcctatgaaccagtttgggccattggaacgggaaaagtagcaactcccgta
gaagcggaagaagcgcatgcctttatccgaaaagaaattggcaaattatttgttggtgca
gaccttgtggcggagaacattcaaattctttatggtggttcagtcaaacctgacaacatc
aaggaacttctcgccaaaccaaatattgacggtggcctcgttggtggagccagtcaaaaa
ttggatttatttttaggacttttaaaataa

DBGET integrated database retrieval system