KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I2430Help
Entry
LEPBI_I2430       CDS       T00693                                 

Definition
di-heme cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Brite
Enzymes [BR:lbi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     LEPBI_I2430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2504007..2504993)
Genome map
AA seq 328 aa AA seqDB search
MLKQKFTPYFMTIALFSLVFCGPSEETKDIQGKAKQIIGALPETMPGSENDTEKLISLGK
KLYFEKKLSLNETQSCNSCHNIEGKSAGVDNLPTSPGAFGKNGDRNSPTVLNAGFHFVQF
WDGRAADLKAQAKGPILNPVEMAMPSEKEVLKRINEDPEYPKLFAEAFPNDQNPITYDHL
AGAIAAFERTLVTQSRFDDFVKGDFKAISKAEQEGFKSFLAAGCTSCHSGNLLGGNSFRK
LGLVNEFKTEDLGLFKITKKPEDKFVFKVPSLRNITLTGPYFHDGKISTVEEAVQKMAYH
QLGINLSEEEIKKIVLFLGTLADKNRVN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacaaaaatttacaccttatttcatgacaatagcgctcttttcattggtcttt
tgtggtccctcagaagaaacaaaagatatccaaggaaaagcaaaacaaatcatcggtgca
ttgcccgaaacgatgccaggatcagagaatgatactgagaaactgatttcacttggtaaa
aaactatattttgagaagaaactttctctgaatgaaacgcaatcttgcaattcctgtcat
aatattgaaggcaaatctgcgggagtagacaaccttccgacttctcctggagcatttggt
aaaaatggagataggaattctcccactgtactcaatgcgggatttcactttgtccaattt
tgggatggaagagcagcggatctgaaagctcaagccaaaggtccgattctgaatccagtc
gaaatggcgatgccgtctgaaaaagaagtcttaaaaagaatcaatgaggatcccgagtat
ccaaaactttttgctgaagcatttccgaatgatcaaaatccaatcacatacgatcatctt
gcaggagctattgcagcatttgaaaggacactcgtgacgcagtcgcgcttcgatgatttt
gtgaaaggtgactttaaagcaatttcaaaggcagaacaagagggttttaagagttttctt
gctgcaggatgtacatcttgccactctggaaatttacttggcgggaattctttccgtaaa
ttaggtcttgtcaatgaatttaagacagaagatttggggctatttaaaatcactaaaaaa
ccagaggacaaatttgtcttcaaagtgccaagcttacgcaacatcaccttgacgggtcca
tatttccatgatggtaaaatttctactgttgaagaagctgttcaaaaaatggcgtatcac
caattgggaattaacctttcggaggaagaaatcaaaaaaatagtattgtttttagggacc
cttgctgataaaaatcgcgtgaattaa

DBGET integrated database retrieval system