KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I2608Help
Entry
LEPBI_I2608       CDS       T00693                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00260  Glycine, serine and threonine metabolism
lbi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lbi01100  Metabolic pathways
lbi01110  Biosynthesis of secondary metabolites
lbi01130  Biosynthesis of antibiotics
lbi01230  Biosynthesis of amino acids
Module
lbi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LEPBI_I2608 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LEPBI_I2608 (trpB)
Enzymes [BR:lbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LEPBI_I2608 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABZ98687
UniProt: B0SM57
Position
I:complement(2697478..2698668)
Genome map
AA seq 396 aa AA seqDB search
MGKNQPGYFGEFGGRYAPEILTEALEELESTYQKLKKSKKFKKELEFYLQNYVGRPSPLT
YAERLTKQWGGARIWLKREDLNHTGAHKINNAIGQALIAKFMGKKRIIAETGAGQHGLAT
ATVGAMFGMETVVYMGAVDVERQNLNAKKIEMLGAKILPVTAGEATLKEATSEAMRDWAL
NVSTTHYIVGSAIGPHPFPTIVRDLQSIIGKEARSQFKKRNHNLPHAIVACVGGGSNAIG
MFHAFLKDKHVAIYGAEAGGLGPKPGEHSATLTYGKTGFLHGTKTLIIQDEAGQIVPAHS
VSAGLDYPGVGPEHAYLSQTKRVDYRMVTDEQALDCFLEVTRVEGIIPALETAHAFYVAR
DVAKDLGKKKDLIICLSGRGDKDVTEVLRILGERSK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaaccaacctggatattttggagaatttggtggcagatacgcacccgaaatt
ctaaccgaagctctcgaagagcttgaatccacctatcaaaagttaaagaagagtaaaaag
ttcaaaaaagaattggagttttacttacagaactatgtcggaagacctagccctttaact
tatgcagaacgtctcaccaaacaatggggaggtgctcgtatatggctaaaacgtgaagac
ttaaatcatacaggtgcacataaaattaacaacgccattggacaggcgttaattgcaaaa
tttatgggcaaaaaaagaatcatcgcggaaacaggtgcaggccaacacggcttagccaca
gcgacagtgggtgccatgttcggaatggaaaccgttgtttacatgggtgcggtggatgtt
gaaaggcaaaatctaaatgcaaaaaaaatagagatgttaggtgccaaaattttacctgtg
actgcaggtgaggcaactttgaaagaagcaactagtgaagccatgcgtgactgggcatta
aacgtttccacaactcactacatcgtaggctcagcgattggaccacatcctttccctacc
atcgtacgtgatttacaatccatcatcggtaaggaagcaagatcacaattcaaaaaaaga
aatcataatctcccacatgccatcgttgcctgtgtgggcggtgggtctaatgccattggt
atgttccatgcatttctaaaggacaaacatgttgccatttacggtgcggaagcaggtggg
ctaggtccaaaaccaggcgaacattctgcaactttaacctatgggaaaaccggtttttta
catggaaccaaaactcttatcatccaggatgaggcaggtcaaattgttccggctcattcc
gtatctgcaggactcgactatccaggagtcggaccagaacacgcttatctgtcacaaacc
aaacgagtggattatcgtatggtgacagacgaacaggcattagattgttttttggaagtg
actcgtgtagaaggaatcattcctgcgttagaaacagcgcatgctttttatgtagcaaga
gatgttgcaaaggatttaggaaaaaagaaagacctaatcatttgtttgtccgggcgaggt
gataaagatgttacggaagttttgcggatactaggtgaaagaagcaaatga

DBGET integrated database retrieval system