KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I3293Help
Entry
LEPBI_I3293       CDS       T00693                                 

Definition
putative zinc-binding alcohol dehydrogenase (EC:1.1.1.-)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LEPBI_I3293
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEPBI_I3293
  Lipid metabolism
   00071 Fatty acid degradation
    LEPBI_I3293
  Amino acid metabolism
   00350 Tyrosine metabolism
    LEPBI_I3293
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LEPBI_I3293
   00626 Naphthalene degradation
    LEPBI_I3293
Enzymes [BR:lbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LEPBI_I3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3405194..3406234
Genome map
AA seq 346 aa AA seqDB search
MKAAVLPSGSRSLEIQELDLPPLPPNQVKVKVKACGICGSDIHFILHGKMKATYSPCVPG
HETSGVVAEIGDQVTKFKLGDRVVVSAGTSCGKCKHCLAGRENLCENIGVIGFNQRGGFA
EFIQTEERYLHLLPEEIPFAEGAILADAVSTPYHAIKYQGELKAGESVAIIGCGGLGIHA
VAIAKALGAAKIYAIDIDSGSLENAKAYGADELILVEKNMQVGKVLKEKSGGIDLLCDFT
GYMPNIESSVRAMNRGGRIVLVGIGRNKLEIPMPFFLIERQIRITGSYGSDRRAIPELIQ
LYQEKKLNLTKSISGIHKLEDTNEFLHALEEKKGNPIRFIINPELS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgtattaccttcgggatcgagatccctagaaatccaagaattagacctt
ccaccactcccaccaaaccaagtcaaggtgaaagtaaaagcatgtgggatctgcggatca
gacattcatttcattttacatggaaaaatgaaggccacgtattctccttgtgtacctggt
cacgaaacttcaggagttgtcgcagagattggagaccaagtcactaaatttaaattaggt
gaccgagtggtagtgagtgcggggacatcttgcggaaaatgcaaacattgtttggcagga
agagaaaatctttgcgaaaatatcggcgtcattgggttcaaccaaagaggaggatttgca
gaattcatccaaacagaagaaaggtaccttcatttattaccagaagaaattccgtttgcc
gagggagccatccttgctgatgccgtatccactccctaccatgctatcaaataccaaggt
gaattaaaagcaggcgaatcggtggccatcatcggatgtggtggactcggaatccatgca
gtggcaattgctaaagcccttggagcggcaaaaatttatgccatagatattgatagtgga
agtttagaaaatgcaaaagcatatggtgccgacgaactaatattagtcgaaaagaatatg
caagttgggaaagttttaaaagaaaagtcgggtgggatcgatctattatgcgactttact
ggttacatgccaaatattgaaagtagtgttcgtgccatgaaccgaggaggaaggattgtc
cttgtggggattggaaggaataaactcgaaatcccgatgccattttttcttatcgaaagg
caaatccgaatcacagggtcttatggttcggatcgacgggccattccagaactcatccaa
ctctatcaggaaaaaaaattgaatctcactaaatccatcagtgggattcataaactggaa
gatacgaacgaattcttacatgcgttagaagaaaaaaaagggaatcccattcgtttcatc
atcaaccctgagttatcataa

DBGET integrated database retrieval system