KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I3450Help
Entry
LEPBI_I3450       CDS       T00693                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00010  Glycolysis / Gluconeogenesis
lbi00620  Pyruvate metabolism
lbi00640  Propanoate metabolism
lbi00680  Methane metabolism
lbi01100  Metabolic pathways
lbi01110  Biosynthesis of secondary metabolites
lbi01120  Microbial metabolism in diverse environments
lbi01130  Biosynthesis of antibiotics
lbi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEPBI_I3450 (acsA)
   00620 Pyruvate metabolism
    LEPBI_I3450 (acsA)
   00640 Propanoate metabolism
    LEPBI_I3450 (acsA)
  Energy metabolism
   00680 Methane metabolism
    LEPBI_I3450 (acsA)
Enzymes [BR:lbi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LEPBI_I3450 (acsA)
Lipid biosynthesis proteins [BR:lbi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LEPBI_I3450 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABZ99510
UniProt: B0SRX5
Position
I:complement(3570278..3572242)
Genome map
AA seq 654 aa AA seqDB search
MPKERIVAPSKEFAKLANVSLKEYKSKYKESIEKPEKFWAEQAKRLTWFKKWTKVLRHDF
AKAKVEWFVGGKLNVSYNCLDRHLDSPLKNKAALIWEGDNPDESKVLTYHDLHREVNHFA
NVLKKFKVKKGDRVLIYLPMVPELAIATLACTRIGAVHSVVFGGFSPEALLGRIEDCKPT
LVITADGGYRGGKPIELKKNVDAALAETKFKVNDVIVVKRTGDEGNLNWKEGRDHWYHYL
MKDPEVKKECPAVPMESEDPLFILYTSGSTGKPKGVLHTTAGYLLGANLTFATIFDYKDT
DTYWCTADIGWITGHSYILYGPLSNGATSLMFEGVPSYPDMGRFWDVIDKYKVTVFYTAP
TAIRALMREGLEHIKKRSLASLRLLGSVGEPINPEAWEWYYANIGKSKCPIVDTWWQTET
GSIMISGIPGAIPQKPGSASWPFYGIQPVLVDNEGVELKGKGEISGNLCIAKPWPSMMRG
VYGDPKRFFDTYFSQFKGYYFTGDGANRDKEGYFRITGRVDDVLNVSGHRIGSAEVESAL
VEHKSVAEAAVVGFPHDIKGQGIYAYVTVKQGVVTNDLLKKELIAMVEKVIGKIARPDVI
HWAPGLPKTRSGKIMRRILRKIANNEFDTLGDISTLADPSVVQSLIDDKKKYHS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagaaagaatcgtggcaccatccaaagaatttgccaaacttgcaaacgttagc
ttaaaagaatacaaatccaaatacaaagaatccattgaaaaaccagagaaattttgggca
gaacaagcaaaacgcctaacatggtttaaaaaatggaccaaagttctgagacacgacttt
gcaaaagcaaaagtagaatggtttgtggggggaaaactcaatgtctcttataattgttta
gaccgccaccttgactctcccttaaaaaacaaagccgctctcatatgggaaggtgacaat
cccgacgaatccaaagtcctcacctatcacgacttacatagagaagtgaatcactttgcc
aatgtactaaaaaaattcaaagtgaagaaaggagaccgagttctcatctaccttccgatg
gtcccagaacttgccatcgccacacttgcttgtactcgcatcggggccgtgcattccgtt
gtctttgggggattttctccagaagcactccttggtcgtatcgaagattgtaaaccaact
cttgtcatcacagccgatggtggataccgtggtggcaaacccatcgaactgaaaaaaaat
gtcgatgctgccctcgctgaaaccaaattcaaagtgaatgatgtgattgtcgtcaaacga
acgggtgatgaaggcaatctcaattggaaagaaggtcgtgaccattggtatcactacctc
atgaaagaccctgaagtgaaaaaagaatgccccgctgttcctatggaatcggaagaccca
ctcttcatcctttacacatctggttccacgggaaaaccaaaaggggtcctccataccacc
gccgggtatttgttaggtgccaatctaacattcgctactatctttgattacaaagacacg
gatacatactggtgtacggcagacattggttggatcacgggtcatagttatatattgtat
ggaccactctccaatggtgctacttccttgatgttcgaaggggttccgagttaccctgac
atgggtcgattttgggatgtgattgataaatacaaagtcaccgtattttataccgcaccg
acggccattcgggcactcatgcgagaaggtctagagcatatcaaaaagcgatcactcgca
tcactgcggttacttggttctgtgggagaacccattaacccagaagcttgggaatggtat
tatgctaatattggaaaatcgaaatgcccgattgtggatacatggtggcaaacagaaact
ggatccattatgatctcagggattccgggagccattccgcaaaaaccaggatcggccagt
tggccattttatggaatccaaccagtacttgtggacaacgaaggggtggaactgaaaggc
aaaggtgaaatttcaggcaatctttgtatcgcgaaaccttggccttcgatgatgcgcgga
gtgtatggagatccgaaacgattctttgatacctacttctctcaattcaaaggctattat
ttcacaggggatggggccaatcgtgataaagaaggatactttcgcatcacagggcgagtc
gatgatgtcctcaatgtctcagggcatcggattggatcggcagaagtggaaagtgccctt
gtggaacacaaatcggtggcggaagcggctgttgtgggtttcccacatgacatcaaaggc
cagggaatttatgcctatgtcacggtgaaacaaggggttgtcacaaacgacctactgaaa
aaagaactcattgcgatggtggaaaaggtgattggaaaaatagcgaggccagatgtgatc
cattgggccccaggacttcctaaaactcggtctggtaaaatcatgcgtcgaattttacgg
aagattgccaataacgaatttgatacgttaggtgacattagtacacttgccgatccatcc
gttgtccaatcgttaattgatgataagaagaaataccatagttaa

DBGET integrated database retrieval system