KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I3463Help
Entry
LEPBI_I3463       CDS       T00693                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LEPBI_I3463 (recR)
DNA repair and recombination proteins [BR:lbi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LEPBI_I3463 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3581501..3582109
Genome map
AA seq 202 aa AA seqDB search
MEGSHLSDPQFQKLIQAFSSLPGIGKKSATRIGFHILRMDPSTFQSWINHIEEAKTKLRF
CDDCGGLTEDSICSICLSDRRDNGILCVVEQPEDIFFIENTKEYSGKYHVLNGAISPLDG
IGPEQLRIKQLMQRLDIGNIKEVLIATNPTLEGDATASYLSTVIKPMEIKITRIAHGITI
GGTLEYSDQYTLGKAIKSRLTL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggagggttcccacctgtctgatcctcaattccaaaaactcatccaagctttttcgagc
ctacctggaatcggaaaaaaaagtgcaactcgaattggatttcatatcttacgtatggat
ccatctaccttccaatcttggatcaatcatatcgaagaagcaaaaaccaaacttcgattt
tgtgatgactgtggtggattaacagaagattcgatttgttcgatttgtttgtcagacagg
cgagataatggaattttatgtgtcgtggaacaaccagaagatattttctttatagaaaac
acaaaggaatactccggtaaataccatgttctaaatggtgctatctcaccattggatgga
attggaccagaacaattacgtatcaaacaattgatgcaacgtttggatataggaaatatc
aaagaagtattaattgctacaaatcctactcttgaaggggacgcaactgcatcttatcta
tcgacagtcattaaaccaatggaaattaaaatcacaaggatagctcacgggattactatt
ggtggaacgttggaatattccgaccaatacactttaggtaaggcaattaaatcgagactg
acgttgtaa

DBGET integrated database retrieval system