KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_II0080Help
Entry
LEPBI_II0080      CDS       T00693                                 

Gene name
galU1
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LEPBI_II0080 (galU1)
   00052 Galactose metabolism
    LEPBI_II0080 (galU1)
   00500 Starch and sucrose metabolism
    LEPBI_II0080 (galU1)
   00520 Amino sugar and nucleotide sugar metabolism
    LEPBI_II0080 (galU1)
Enzymes [BR:lbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LEPBI_II0080 (galU1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:76385..77797
Genome map
AA seq 470 aa AA seqDB search
MEKETSDQLIRETMKTAGLSDSFIADFIQKVDAVRNGETGMVRWEEVGDLDPNADEISLE
EIHSSYPLDRALLSKLVVIKLNGGLGTSMGLDKAKSLIPIKGTLSFLSVMSKQIEFLRTK
FGIEVPLLFMDSYNTQEDSQKELKLNGFKQTLRSSFLQHKVPRLDAKTYAPIQSKVEKDN
WCPPGHGDIYFTMMEEGILDELLNKGFEIAFLSNGDNLGATVDPQIVSYLLKENIHFAME
MTPKTLADKKGGAIYRKLVGGKMTQYELLETAQVPKEYEHEFSGLGKFRTFSTNNLWINL
RALKERFNQGNFSLSLIVNPKQVDGKDIIQLETAMGSAVGNFSKFKGIIIPRDRFAPVKK
TEDYLIRRSDAYVLNEDFSLTMAKERKEKGLGEVLVSLDEKHYKKIQQFDALFVSLPSLL
YCEELVVEGEVLFDVPVTIKGKVKFQNTSGTLKKLSSLNKTDFENQTITL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagaaacctcagaccaattgattcgcgaaaccatgaaaacggccggactttcg
gactcgttcattgctgattttattcaaaaggtagatgccgttcggaatggagaaacgggc
atggttcgttgggaggaagtgggagatttggacccaaatgccgacgaaatttctttagaa
gaaatccatagttcttatcctcttgatcgggctctcctttccaaacttgtagtcatcaaa
ctgaatggtgggcttgggacgagcatgggcctcgacaaagcaaagtctctcatcccgatc
aaaggtacattgtcctttctttcggtaatgtccaaacaaattgaattcttacgaaccaag
tttggtattgaagtgccccttctttttatggattcatacaatacccaagaagattcacaa
aaagaattaaaactaaatggcttcaaacaaacattacgttccagttttttgcaacacaaa
gtaccaaggttggatgcaaaaacctacgcacccattcaatccaaggtagaaaaagataac
tggtgccctcctggtcatggtgatatttattttacgatgatggaagaagggattttggat
gaacttttgaacaaaggttttgaaattgcatttctttccaatggtgataatttaggggca
actgttgacccacaaatagtttcttatttactcaaggaaaacatccattttgcaatggag
atgacaccaaaaacgttagctgataaaaaaggtggcgccatctaccgtaagttagttggc
ggtaagatgactcaatatgaacttttggaaacggcacaagtaccgaaagaatatgaacat
gaatttagtggactcggaaaatttagaacgttttctacaaacaatctttggatcaactta
cgtgctttaaaggaaagatttaaccaaggtaacttttccctttctcttatcgtcaatcca
aaacaagtagatggaaaagacatcattcaattggaaacagccatgggaagcgccgtcggg
aatttttccaaattcaaagggatcatcataccaagagatcgatttgcacctgtgaaaaaa
accgaagattatttgatcaggcgctccgatgcgtatgtattaaatgaagatttttcattg
accatggccaaagaacgaaaagaaaaaggccttggcgaagtgcttgtctctttggatgaa
aaacattataaaaaaatccaacaatttgatgcactctttgtttctttaccatccttgtta
tattgtgaagaattggtggttgagggagaggttttatttgatgttcctgtgaccatcaaa
ggaaaagtgaaattccaaaacacatcggggacactcaaaaaactatcttcattaaacaaa
acggattttgaaaatcaaaccattaccttatga

DBGET integrated database retrieval system