KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_II0179Help
Entry
LEPBI_II0179      CDS       T00693                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LEPBI_II0179
   01230 Biosynthesis of amino acids
    LEPBI_II0179
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEPBI_II0179
   00030 Pentose phosphate pathway
    LEPBI_II0179
   00051 Fructose and mannose metabolism
    LEPBI_II0179
   00052 Galactose metabolism
    LEPBI_II0179
  Energy metabolism
   00680 Methane metabolism
    LEPBI_II0179
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LEPBI_II0179
Enzymes [BR:lbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LEPBI_II0179
Protein phosphatases and associated proteins [BR:lbi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LEPBI_II0179
Messenger RNA biogenesis [BR:lbi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LEPBI_II0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(176216..177523)
Genome map
AA seq 435 aa AA seqDB search
MNENDTKVEQFGPCTFPNPAGYDYWTEDNSVVLFQTIFSGPDDAKKTIETSPVFFEQAGP
KEKIYFRPEEVTAGIVTCGGLCPGINDVIRALVMELHYRYKVPRILGFPFGYEGLVKKFG
HRPIELTPDKVAHIMNFGGSILGSSRGNQKIEEMVDTLFLYGVKMLFCIGGDGTLRGAQA
IQEEVKKRKEDIAIVGIPKTIDNDINYVQKTFGFSTAFSKAVEAVNCAHEEAKGAPNGIG
LVKLMGRHSGFIAVNSALASKNVNFVLIPELDFDLEGEGAFLPVLKDRVQRRGHAVVIIA
EGAGQKYFEDKGEKDRSGNKKLADVGVYIKDKITEYFQKEGVALNLKYIDPSYIIRSVPA
NAEDSVFCGFLAQNAVHAAFAGRTGCVVGIWNNVFTVMPISLAIAERKVLRPERSTLWRA
LLASTGQPNSMKAKV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaacgatacaaaagtagaacaatttggaccttgtaccttcccaaacccagcg
gggtatgactactggacagaagacaattcggttgtgctcttccaaaccatcttttctgga
ccagacgatgcaaaaaaaaccatcgaaacaagtcccgttttctttgaacaagccggtccg
aaggaaaaaatctactttcgacccgaagaagtgacagcagggatcgttacctgtggggga
ctttgccctgggatcaatgatgtgatccgagcacttgtgatggaattgcactatcgttat
aaagtaccgaggatcctcggattcccttttgggtatgaagggttagtgaaaaaatttgga
cataggcccattgaactcactcctgataaggtggctcatatcatgaattttggtgggtcc
atccttgggtcttccaggggcaatcagaagattgaagagatggtcgatactttgttttta
tatggtgtgaagatgttgttttgtatcggaggggacgggaccttacgcggagcccaagcc
atccaagaagaagtgaaaaaacgaaaggaagacatcgccatcgtaggcattcccaaaacc
atcgacaacgatatcaattatgtccaaaaaacatttggattttcgacagcctttagtaag
gcggtggaagctgtgaactgcgcccatgaagaagcaaaaggagcaccgaatgggattggt
cttgtgaaactgatggggcgccactccggattcattgctgtgaattctgctttggcttct
aagaatgtaaactttgtcctcatccctgaacttgattttgatttagaaggagagggtgct
tttctgcctgttttaaaagacagagtgcagagacgaggccatgcggttgtcatcatcgcc
gaaggggcagggcaaaagtacttcgaagacaagggagaaaaagatagatcgggtaacaag
aagttggcggacgttggtgtatacatcaaagataaaatcaccgaatactttcaaaaagaa
ggtgtggcactgaatctaaaatacattgacccgagttacatcattcgttccgtgcctgcc
aatgcggaagattccgtgttttgtggattcctagctcaaaatgccgtgcacgctgcgttt
gcaggtcgtacaggatgtgtggtcgggatttggaacaatgtgtttacggtgatgcccatt
tctttggcgattgcagaacgaaaggtacttaggccagagcggagtacgttatggcgagca
ctccttgcttccacgggccaaccgaattcgatgaaggcgaaagtttaa

DBGET integrated database retrieval system