KEGG   Leptospira borgpetersenii JB197: LBJ_0045Help
Entry
LBJ_0045          CDS       T00404                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lbj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:56149..56991
Genome map
AA seq 280 aa AA seqDB search
MESKYDLNSGIYFPTIFGVLNITEDSFSDGGKYLTLKASSEKADSLLIQGASVVDIGAQS
SNIQANLVGSEIEWMRMKDLIPDLLAKGVRISVDSFQPEVIANSLDAGVEFINHIRGFVD
KESVREVSKYAGTNRKFIVMYSHNHANRPDTQSYLTSQNVIFEIVKFFRERKKVLLNEGI
TQEQLIFDPGMGFFLSPDFQVSFEVLRRIQTLKEEFSPMMVSVTKKSFLGNALGGLKVNE
REIATVVAELYLSIQNVEYIRTHEPKNLKQALEIWNLLRS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaagtatgatttgaattctgggatttatttccctacgatcttcggagtgtta
aacattaccgaggattcgttttcagacggaggaaaatatctcactctgaaagcttcttcc
gaaaaagcagactcccttctgattcaaggtgcaagtgtagtcgatattggcgctcagtct
tccaacattcaggcaaatctagtcggctccgaaatcgaatggatgagaatgaaagatctt
ataccagacttactcgcaaagggagtccgcatttctgtggattcatttcagcccgaagta
atcgcaaattctttggatgccggtgtggaatttatcaaccatattcgtggatttgtggat
aaagaatccgttcgagaagtttcaaaatacgcaggaacaaatcgaaagtttatcgtgatg
tattctcataatcatgcgaatcgtcccgacacgcaatcttatctgacttcacaaaatgtg
attttcgagatcgtaaaattctttcgagaaagaaaaaaggttttattaaacgaagggatt
actcaggaacagttgattttcgatcctggtatgggttttttcttaagccccgattttcaa
gtgagctttgaagttttgagaaggattcagactctcaaggaagaattttctccaatgatg
gtttcggttacgaaaaagtcctttttggggaatgcgctcgggggtttgaaagtaaatgaa
cgggagattgccactgtggttgcggaactttatctttccattcaaaacgtggaatatata
cgaactcacgagccgaaaaatttgaaacaggctttagaaatttggaatttacttcgttca
tga

DBGET integrated database retrieval system