KEGG   Leptospira borgpetersenii JB197: LBJ_0913Help
Entry
LBJ_0913          CDS       T00404                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBJ_0913 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBJ_0913 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LBJ_0913 (trpB)
Enzymes [BR:lbj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LBJ_0913 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1097433..1098635
Genome map
AA seq 400 aa AA seqDB search
MGKVRHSPKEGYFGEFGGRYSPEILHDALAELETTYKKLKKNKHFKKELEYYRKNYIGRP
SPLTYAERLTKVWDGARIWLKREDLNHTGAHKINNTIGQVLIAKAMGKTRIIAETGAGQH
GVATATVGAMFQMETVVYMGEEDLRRQELNAIRMRMMGAKVVGVSSGTATLKDATSEAMR
DWALNVSNTHYIVGSSIGPHPFPTIVRDFQSVIGIESRKQFKKVNGKLPNAVIACVGGGS
NSIGMFYGFLRDKKVKLFGVEAGGYSTEPGHHSATIQFGRTGFLHGTKTLVIQDEFGQIV
PAHSVSAGLDYPGVGPEHAYFHKSGRVTYVNVDDDGALDAFLEICQIEGIIPALETAHAF
RFAKDLAKSMGKKEDILICLSGRGDKDVAEVARLRKGEFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtacgtcattccccaaaagaaggttacttcggagaattcggcggtcgctat
tctcctgaaatccttcacgacgctcttgcggaacttgagaccacatacaaaaagctcaag
aaaaataaacacttcaaaaaagaactcgaatattatcgtaagaattatatcggaagacct
tctccgcttacatacgcggaacgtctcaccaaggtctgggacggtgcgagaatctggctc
aaacgagaagatttgaatcatacaggcgctcataagatcaacaatacgatcggacaagtg
ttgatcgcaaaggcgatgggcaaaactcgaattattgcggaaaccggagcggggcaacac
ggggttgcgaccgcaaccgtgggtgcgatgtttcagatggaaacagtcgtttatatggga
gaagaggatcttcgtcgccaggaactcaacgcgatccggatgagaatgatgggcgccaaa
gtcgtaggtgtttcaagcggaaccgcaactctcaaagacgctacgagcgaagcaatgcgc
gattgggcattaaacgtttctaatacacattatatcgttggttcttccatcggtcctcat
ccgtttcctaccatcgtaagagactttcaatcggtaatcggcatcgaatccagaaaacaa
tttaaaaaagtgaacggtaaacttccaaacgctgtgatcgcctgtgtcggcggcggttcg
aactcgatcggtatgttctacggtttcttaagggataagaaggtgaaactttttggcgta
gaagccggaggttattctaccgaacctgggcatcattctgcaacaatccaattcggtaga
accgggtttttacatggaaccaaaacgttggtgatccaagatgaattcggacaaatcgtc
ccggcacattccgtgtctgcaggtttggattatcctggggtcggtccggagcacgcttat
tttcataaaagcgggagagtgacttacgtgaacgtggatgatgacggtgctttagatgct
tttctcgagatatgtcagatcgaaggaatcattcctgcattagaaactgctcatgcgttt
cgttttgcaaaagatctggcgaaatcgatggggaaaaaagaagacattctcatctgcctt
tccggaagaggagataaggatgttgccgaggttgcaaggcttagaaaaggagaattttct
tga

DBGET integrated database retrieval system