KEGG   Leptospira borgpetersenii JB197: LBJ_0914Help
Entry
LBJ_0914          CDS       T00404                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBJ_0914 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBJ_0914 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LBJ_0914 (trpA)
Enzymes [BR:lbj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LBJ_0914 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:1098632..1099426
Genome map
AA seq 264 aa AA seqDB search
MSAISSVFSSDKSVFIPYISLGDPDYESCISWADALIRGGAGILELGIPFSDPVADGPVI
QKAFKRALAYPFSMKKILEITAEIHKLHPETPLVYLTYFNPLYSMGLEAFTESAKNSGIQ
GLIIPDLPFDTSEAEEFFSQLERKKIDFIHLVTPATTIDRIQSMKSFASGFIYYVTSYGV
TGERRALAVGLKERIQMVRNKVGLPVCAGFGISTADQAKEISTYANGVIIGSAVQKIIEE
SGSNREVCISKLFTYASEIRASMK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgctatttcttccgttttttcctccgataaaagcgttttcattccttatatctct
ttgggagatccggactacgagtcttgtatttcttgggcggatgctctgattcgaggtggt
gctggaattttagaattgggaattccattttccgatccggtcgcggatggcccggtgatt
caaaaagcctttaaacgagcgttggcttatcctttctccatgaaaaaaattttagagatc
accgcagaaattcataaattacatccagaaactcctctcgtgtatttaacgtattttaat
ccgctttattctatgggtttggaagcttttacggagagtgcaaaaaattcggggatccaa
ggtttgattatcccggaccttccgtttgacacctcggaagcagaagagtttttttctcaa
cttgaacgaaaaaagatcgatttcattcatcttgtaactcctgcaactactatcgatcgg
attcaatctatgaaatcttttgcatccggttttatctattatgtgacttcctacggtgtc
accggggaacgtcgtgctctcgcggtcggtttgaaagaacggattcaaatggtgcgtaac
aaggtcggcctcccggtttgcgcggggttcggaatttccactgcggaccaggctaaggaa
atttcgacttacgcgaatggggtgattatcggttctgccgtacaaaaaatcatcgaagag
agtggctccaatcgggaagtttgcataagtaaactttttacgtatgcatcggaaattcgt
gcttctatgaaatga

DBGET integrated database retrieval system