KEGG   Leptospira borgpetersenii JB197: LBJ_0928Help
Entry
LBJ_0928          CDS       T00404                                 

Gene name
cheB
Definition
chemotaxis response regulator
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LBJ_0928 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    LBJ_0928 (cheB)
Enzymes [BR:lbj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     LBJ_0928 (cheB)
Two-component system [BR:lbj02022]
 CheA family
  CheA-CheYBV
   LBJ_0928 (cheB)
Bacterial motility proteins [BR:lbj02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    LBJ_0928 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1113744..1114811
Genome map
AA seq 355 aa AA seqDB search
MVPSPVRVVIIDDSLLVRNIISDQIQKDSNIHVIATGKTGVDCIDLAQKMNPDVIILDVE
MPVMDGLTALHELQKKKLGIPVIMLSVLTQNGAEATFKALEYGAIDFVPKPSSVFQFDPE
EIGKILKSKILAYFESRVRREVLKKVSVLAKVPVGEPHVKKSPVQAICIGTSTGGPRALQ
EVFSRIPEDISLPIFVVQHMPAGFTKAFAMRLNDHSKIKVKEAEDGESIEPNTGYVAPGD
AHLSIHSKGGRKWIALSREGLVNGHRPSIEVLLNSAIEEYKSGMIGVIMTGMGKDGSAAM
VKVREAGGSTIAQDEQTSVIYGMNRQAVEMGGVEYIEPVTEIINRIQIILKERGI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggttccgagtccggttcgtgtggttattatcgatgattctctactagtcagaaatatc
atctccgatcagattcaaaaagattcgaacattcacgttattgcaaccggcaagaccgga
gtggattgtatcgatcttgcgcagaaaatgaatccggatgtgatcattctcgatgtggaa
atgcctgtcatggacggtctcacggcgcttcatgaacttcaaaaaaagaaacttggaatt
ccggtcatcatgctttccgttttgactcaaaacggcgccgaagcgactttcaaagctttg
gaatacggcgccattgactttgtgcccaaaccttccagcgtctttcaattcgatccggag
gaaatcggaaagatcttaaaatctaaaattcttgcttacttcgaaagccgggttcgaagg
gaagttttaaagaaagtctccgtacttgcaaaggttccggtaggagaacctcacgtaaaa
aaatctccggttcaagcgatttgtatcggtacttccaccggcggtcctcgggcgcttcag
gaggtattttccagaattcccgaagatatttccctgcctatctttgtcgtacaacatatg
ccggcaggttttactaaggcctttgcaatgagacttaacgatcactcgaaaatcaaagta
aaggaagccgaggatggagaatccatcgaaccaaatacgggttatgtggctccgggtgat
gcgcatttgtccattcactctaaaggtggaaggaaatggattgccctaagcagggaagga
cttgtaaatggacacagaccttccatcgaagttctcctaaacagtgcaattgaggaatat
aagagtggaatgatcggcgtaattatgaccggcatgggcaaggacggttcagcggccatg
gtaaaagtcagggaagccggaggttctacgatcgcacaggacgaacaaacttccgtaatt
tatggaatgaaccgtcaggccgttgaaatgggaggcgtcgaatatatcgagcctgttact
gaaatcatcaataggatccaaatcattttgaaagagagaggaatttaa

DBGET integrated database retrieval system