KEGG   Leptospira borgpetersenii JB197: LBJ_1081Help
Entry
LBJ_1081          CDS       T00404                                 

Definition
lipase/acylhydrolase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LBJ_1081
Enzymes [BR:lbj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     LBJ_1081
   3.1.2  Thioester hydrolases
    3.1.2.-  
     LBJ_1081
Lipid biosynthesis proteins [BR:lbj01004]
 Fatty acid synthase
  Component type
   LBJ_1081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1302221..1302859
Genome map
AA seq 212 aa AA seqDB search
MFLFRILIFISSCSLFTSIHAESNVPKIRILFFGDSLTAGLGLGSPEEAFPALVEKELFK
SGISTQAINAGMSGDTTSGGLARLDWAMSSGFDLFVLELGANDSMRGISPDQTEKNLKEI
IVRVKKKNPKVKILLVGMKTFPNLGKEYRKKFEAVFPKIAKEENLPLVPFFLNGVAGVKK
LNQKDGIHPTAEGHRILAKNLFPFIQKILKKE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtttctttttaggatcttaatttttatttccagttgttctttgtttacttcgatccac
gcagagtcgaatgttcctaagattcgaatcctgtttttcggagacagtcttacggctgga
ttggggcttggttctccggaggaggcgtttccggctcttgtggaaaaagaacttttcaag
agcggaatttctactcaagcgatcaacgccggtatgagcggtgacacgacttcgggaggt
cttgctcgtttggattgggcgatgtcatccggttttgatctgttcgttttagaacttgga
gcgaacgattctatgagagggatttctccggatcaaaccgaaaaaaatttgaaagagatc
attgttagagtaaaaaagaaaaatccgaaagtgaagatccttcttgttggtatgaaaaca
tttccgaatctcgggaaagagtaccgaaaaaaattcgaagctgtttttcctaagatcgca
aaggaagaaaatcttccactcgttcctttttttctaaacggagtagcgggagtcaaaaaa
ctcaatcagaaggacggaattcatccgactgcggaaggacataggattctcgctaaaaat
ctttttccgttcattcaaaaaattttgaagaaagaatga

DBGET integrated database retrieval system