KEGG   Leptospira borgpetersenii JB197: LBJ_1504Help
Entry
LBJ_1504          CDS       T00404                                 

Gene name
sdhA
Definition
succinate dehydrogenase flavoprotein subunit (EC:1.3.5.1)
Orthology
K00239  
succinate dehydrogenase flavoprotein subunit [EC:1.3.99.1]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:lbj01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lbj00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:lbj00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:lbj00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1771388..1773301
Genome map
AA seq 637 aa AA seqDB search
MSLDSKIPNGPIEKKWSNHKANIKLVNPANKRKFNIIVVGSGLAGASASATLAELGYNVK
TFCFQDSPRRAHSIAAQGGINAAKNYQNDGDSVYRLFYDTVKGGDFRAREANVHRLAEVS
VNIIDQCVAQGVPFAREYGGHLSNRSFGGAQVSRTFYAKGQTGQQLLLGAYSALSRQIGL
GAVKMYPRTEMVELIVIDGHAKGIIVRDLVTGEFSTHMADAIVLGTGGYGNVFFLSTNAK
GCNVTATWKAHKKGAYFANPCYTQIHPTCIPVSGDHQSKLTLMSESLRNDGRIWVPKNKG
DKRSPADIPESERDYYLERKYPSYGNLSPRDIASRAAKEACDAGLGVGESGQGVYLDFAD
SIKRLGEDKIRDRYENLFQMYEQITGENPYKQPMRIYPAVHYTMGGLWVDYNLMSNLPGL
FVIGEANFSDHGANRLGASALMQGLADGYFILPYTIGNYLAGVGFNSHPKEDHAEAKKAL
SDAKETTKKLLSIQGKRTVDSFHKQLGKLMWDKCGMARNDKGLKEALSEIPNIREEFWKN
VNVPGSGAELNQSLEKAGRVADFLEFAELLCLDALTREESCGGHFREEHQEEGEAKRNDD
KFCHATAWEFNGIGKKPTEHREKLEFENVHLATRSYK
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagattctaaaattccaaacggcccgattgagaaaaaatggtccaatcacaag
gctaatatcaagttagtcaacccagccaacaaaagaaaattcaacatcatcgtagtcggt
tccggtttggcaggagcttccgcatcggcaactctcgcagaactcggttacaacgtaaaa
acattctgttttcaagacagtcctcgtcgtgcgcatagtatcgcggctcaaggtgggatc
aacgccgctaaaaactaccaaaacgacggtgattcagtctatcgtttattctacgataca
gtgaaaggcggcgactttcgcgcaagagaagcgaatgtgcatcgccttgcggaagtttcc
gttaacatcatcgatcagtgtgtcgcccaaggagttcctttcgcgagagaatacggaggg
catctttccaaccgttctttcggcggggctcaagtttccagaaccttctacgcaaaaggt
caaaccggacaacagcttctcttaggagcttactccgctctctctcgtcaaatcgggttg
ggtgcggtaaagatgtatcctagaaccgagatggtggaactaatcgtgattgacggtcat
gcaaaaggaatcatagttcgtgatcttgtcaccggagaattttccactcacatggcggat
gcaattgtgcttggaaccggaggttacggaaacgtattctttctttccacgaatgcaaaa
ggttgtaacgtaactgcaacttggaaagctcataaaaaaggagcatactttgctaacccg
tgttatacgcaaattcacccgacgtgtattcctgtttccggagatcatcaatccaaactg
actttgatgtccgagtcccttagaaacgacggaagaatctgggttccgaaaaataaagga
gacaaacggagtcccgcggacatacccgaatcggaaagagattattatttggaaagaaaa
tacccaagttacggaaatctttctccaagggacattgcatcccgcgcggccaaagaagct
tgcgacgcaggactcggtgtgggagaatccggacaaggagtatatttggattttgcagac
tcgatcaaacgccttggtgaagacaaaatccgggatcgttacgaaaatctcttccaaatg
tatgaacaaatcaccggtgaaaatccttacaaacaaccgatgagaatttaccctgctgtc
cactatacaatgggtggactttgggtggattacaatctaatgagcaacttacccggtctg
tttgtaatcggagaagcaaacttttccgatcacggagcaaaccgcctcggagcgtccgct
ttgatgcagggacttgcggacggatatttcattcttccttatacgatcggaaattatctc
gcaggagtgggatttaattctcatcccaaagaagatcacgcagaagcaaaaaaagctctt
tccgatgcgaaagagaccacgaaaaaacttctttccatccaaggaaaaagaaccgtggat
tctttccataagcaactcgggaaactgatgtgggacaaatgcggaatggcgcgtaatgat
aaaggtcttaaagaagcgttatccgaaattcctaatatccgggaagagttctggaaaaac
gtaaatgttcccggaagtggagccgagctcaatcagtctctcgaaaaagcgggaagagtc
gcggacttcctcgaattcgccgaacttctttgtttagatgcattgactcgggaagaatcc
tgtggaggacatttccgagaagagcaccaagaagaaggagaagcgaaacgaaacgacgat
aaattctgccacgcaaccgcttgggaattcaacggaatcggtaaaaaaccgacagaacac
agggaaaaactggaattcgaaaacgttcacctcgctacaaggagttataaataa

DBGET integrated database retrieval system