KEGG   Leptospira borgpetersenii JB197: LBJ_1504Help
Entry
LBJ_1504          CDS       T00404                                 

Gene name
sdhA
Definition
succinate dehydrogenase flavoprotein subunit (EC:1.3.5.1)
Orthology
K00239  
succinate dehydrogenase flavoprotein subunit [EC:1.3.5.1]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBJ_1504 (sdhA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBJ_1504 (sdhA)
   00650 Butanoate metabolism
    LBJ_1504 (sdhA)
  Energy metabolism
   00190 Oxidative phosphorylation
    LBJ_1504 (sdhA)
Enzymes [BR:lbj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LBJ_1504 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1771388..1773301
Genome map
AA seq 637 aa AA seqDB search
MSLDSKIPNGPIEKKWSNHKANIKLVNPANKRKFNIIVVGSGLAGASASATLAELGYNVK
TFCFQDSPRRAHSIAAQGGINAAKNYQNDGDSVYRLFYDTVKGGDFRAREANVHRLAEVS
VNIIDQCVAQGVPFAREYGGHLSNRSFGGAQVSRTFYAKGQTGQQLLLGAYSALSRQIGL
GAVKMYPRTEMVELIVIDGHAKGIIVRDLVTGEFSTHMADAIVLGTGGYGNVFFLSTNAK
GCNVTATWKAHKKGAYFANPCYTQIHPTCIPVSGDHQSKLTLMSESLRNDGRIWVPKNKG
DKRSPADIPESERDYYLERKYPSYGNLSPRDIASRAAKEACDAGLGVGESGQGVYLDFAD
SIKRLGEDKIRDRYENLFQMYEQITGENPYKQPMRIYPAVHYTMGGLWVDYNLMSNLPGL
FVIGEANFSDHGANRLGASALMQGLADGYFILPYTIGNYLAGVGFNSHPKEDHAEAKKAL
SDAKETTKKLLSIQGKRTVDSFHKQLGKLMWDKCGMARNDKGLKEALSEIPNIREEFWKN
VNVPGSGAELNQSLEKAGRVADFLEFAELLCLDALTREESCGGHFREEHQEEGEAKRNDD
KFCHATAWEFNGIGKKPTEHREKLEFENVHLATRSYK
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagattctaaaattccaaacggcccgattgagaaaaaatggtccaatcacaag
gctaatatcaagttagtcaacccagccaacaaaagaaaattcaacatcatcgtagtcggt
tccggtttggcaggagcttccgcatcggcaactctcgcagaactcggttacaacgtaaaa
acattctgttttcaagacagtcctcgtcgtgcgcatagtatcgcggctcaaggtgggatc
aacgccgctaaaaactaccaaaacgacggtgattcagtctatcgtttattctacgataca
gtgaaaggcggcgactttcgcgcaagagaagcgaatgtgcatcgccttgcggaagtttcc
gttaacatcatcgatcagtgtgtcgcccaaggagttcctttcgcgagagaatacggaggg
catctttccaaccgttctttcggcggggctcaagtttccagaaccttctacgcaaaaggt
caaaccggacaacagcttctcttaggagcttactccgctctctctcgtcaaatcgggttg
ggtgcggtaaagatgtatcctagaaccgagatggtggaactaatcgtgattgacggtcat
gcaaaaggaatcatagttcgtgatcttgtcaccggagaattttccactcacatggcggat
gcaattgtgcttggaaccggaggttacggaaacgtattctttctttccacgaatgcaaaa
ggttgtaacgtaactgcaacttggaaagctcataaaaaaggagcatactttgctaacccg
tgttatacgcaaattcacccgacgtgtattcctgtttccggagatcatcaatccaaactg
actttgatgtccgagtcccttagaaacgacggaagaatctgggttccgaaaaataaagga
gacaaacggagtcccgcggacatacccgaatcggaaagagattattatttggaaagaaaa
tacccaagttacggaaatctttctccaagggacattgcatcccgcgcggccaaagaagct
tgcgacgcaggactcggtgtgggagaatccggacaaggagtatatttggattttgcagac
tcgatcaaacgccttggtgaagacaaaatccgggatcgttacgaaaatctcttccaaatg
tatgaacaaatcaccggtgaaaatccttacaaacaaccgatgagaatttaccctgctgtc
cactatacaatgggtggactttgggtggattacaatctaatgagcaacttacccggtctg
tttgtaatcggagaagcaaacttttccgatcacggagcaaaccgcctcggagcgtccgct
ttgatgcagggacttgcggacggatatttcattcttccttatacgatcggaaattatctc
gcaggagtgggatttaattctcatcccaaagaagatcacgcagaagcaaaaaaagctctt
tccgatgcgaaagagaccacgaaaaaacttctttccatccaaggaaaaagaaccgtggat
tctttccataagcaactcgggaaactgatgtgggacaaatgcggaatggcgcgtaatgat
aaaggtcttaaagaagcgttatccgaaattcctaatatccgggaagagttctggaaaaac
gtaaatgttcccggaagtggagccgagctcaatcagtctctcgaaaaagcgggaagagtc
gcggacttcctcgaattcgccgaacttctttgtttagatgcattgactcgggaagaatcc
tgtggaggacatttccgagaagagcaccaagaagaaggagaagcgaaacgaaacgacgat
aaattctgccacgcaaccgcttgggaattcaacggaatcggtaaaaaaccgacagaacac
agggaaaaactggaattcgaaaacgttcacctcgctacaaggagttataaataa

DBGET integrated database retrieval system