KEGG   Leptospira borgpetersenii JB197: LBJ_1891Help
Entry
LBJ_1891          CDS       T00404                                 

Gene name
glpK-1
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBJ_1891 (glpK-1)
Enzymes [BR:lbj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LBJ_1891 (glpK-1)
Exosome [BR:lbj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBJ_1891 (glpK-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2235711..2237201)
Genome map
AA seq 496 aa AA seqDB search
MSDYIIGIDAGTTGIRIFCFNRSGNVISSSYSEFKQYYPKSGWVEHDAEEIWAKTEKLII
KAIRNGKLSPSKAVAIGITNQRETTVLFDKDTGKPVYNAIVWQCRRTAGICKDLKSKGLE
PLFRKKTGLVLDAYFSGTKIQWILENVKGVKARAEKGKILFGTVDTYLLHRLTNGKSHKT
DHTNASRTLVYNIEKKEWDKELTQILGIPDSILPEAHNSSSLFGRTEKVKGLLDGIPISS
LVGDQQGALFGQLCTEPGEAKNTYGTGCFLLFNTGNNFQISRNNLLTTLGCGPEGKTVYC
LEGSVFIGGAVVQFLRDNLKFFKESKISEKFASSVKKEDEIVFVPAFTGLGAPYWDMNAR
GAILGLTRDTTPEQITKAALKSIALQSYELVEAMENDTGSKLKVLKVDGGATGNSWLMQY
QSDVLGRRVIRPSNVDTTVLGAAFLAGLERGFFPSVADLKKKIKVNKEFFPQMKVAQRER
EIQIWKDSVRRIRTDQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattatatcattgggattgatgctggaaccactgggattcgaattttttgtttt
aacagatccgggaacgtgatttcgagttcctattccgaattcaaacaatactatccgaaa
tcgggttgggtggaacatgacgcggaagagatctgggcaaaaactgaaaaactgatcatc
aaagcgattcgtaatggaaaattaagtccttctaaggccgtcgcgatcggaatcacaaat
caaagagaaaccaccgtcttgttcgataaggatacgggcaagccggtttataatgcaatt
gtatggcaatgtaggagaaccgccggaatttgtaaggatctaaagtcgaaaggtttggag
ccgcttttccgtaaaaaaacggggctcgttttggacgcatacttcagcggaacaaaaatt
caatggattctggaaaatgtgaaaggtgtgaaagcgagagccgagaagggaaaaatactt
tttggaaccgtcgatacgtatttgctccaccggttgaccaatggaaaatcgcataaaacc
gatcatacgaatgctagtaggacactagtctacaatatagaaaagaaggaatgggacaag
gaattgactcagattcttggaattccggattctattcttcccgaagcgcataactctagt
tctcttttcggaagaacggagaaggtgaaaggacttctggacggaattccgatttcttct
ctcgttggagatcagcagggagccttattcggtcaactctgcacggaaccgggggaagcg
aaaaatacctacggaaccggatgttttcttttgtttaacactggaaataattttcagatt
tcaagaaacaatctccttacaactcttgggtgtggtccggaaggaaagacggtttattgt
ttggaaggttccgtttttatcggaggcgccgtcgttcaatttttgagagacaaccttaag
tttttcaaagagtccaagatttccgaaaaattcgcttcctccgttaagaaggaagatgaa
attgtatttgttcccgcattcactggattaggtgctccttactgggatatgaatgcaaga
ggtgcgattttgggtctaacgagagatacaactccggaacaaattacgaaagccgcgttg
aaatcgattgcacttcaatcttatgaactggtggaagcgatggagaacgataccggctca
aagctaaaagtcctcaaagtggatgggggcgccaccggaaactcctggctgatgcagtat
caatccgatgtgttaggaagacgcgtaattcgtccttcgaatgtagatacgaccgtattg
ggtgcggcttttttagccgggcttgaaagaggattttttccctctgttgcggatctgaaa
aagaaaattaaagtaaataaagagtttttccctcagatgaaagtggcacagagagaaagg
gaaattcagatttggaaggattccgtacgaagaatccgcaccgatcaataa

DBGET integrated database retrieval system