KEGG   Leptospira borgpetersenii JB197: LBJ_1968Help
Entry
LBJ_1968          CDS       T00404                                 

Definition
bifunctional dihydrolipoyllysine-residue acetyltransferase/dihydrolipoyllysine-residue succinyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBJ_1968
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBJ_1968
   00020 Citrate cycle (TCA cycle)
    LBJ_1968
   00620 Pyruvate metabolism
    LBJ_1968
Enzymes [BR:lbj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LBJ_1968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2315361..2316776
Genome map
AA seq 471 aa AA seqDB search
MAKIAEMTQLSPTMSEGKIVRWLKQKGDSVSPGEIIAEVETDKAVMEMEAFETGVLLEIL
APEGSLLPVGAPVAIIGKPGEDVSALVEISKKSIPAKKEGSAAPSQTSTSTQSTSSSTAP
TSSAQSGTSASTSGAGAGKNLETKTSVSLSQNAGNSGITANEERTYGFKTSPSFGPGESE
HSPVRSARGGRPIKASPLAKNLALQKGINLTEVIGSGPGGRIIKRDILSYQSGGGNTFVK
RQDRKLEITGMRKTIASRLAHSTSTIPHFYLTTELNAGPIDDLRNSINRDLGLSGQGKVS
VNDLILKACSYTLLQVPEVNSSWREDHILEHGRVDIGVAVSIEGGLITPYIRNAEEKSVL
EISREIKELASRARDRKLKPGEYTDGTFTVSNLGMFGVSSFTAVINEPEAAILAVGALVE
KPVLKAGNIVPGKILNVTLSCDHRVIDGATGSRFLSLFREFMEHPLRLLTG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaattgcagagatgactcaactcagtcccacgatgtcggaaggaaagatcgtc
cgatggctcaaacaaaaaggagattccgtttctcccggagaaatcatcgcggaggtggaa
acggacaaagccgtcatggaaatggaagcctttgaaaccggtgttcttttggaaattttg
gctccggaaggaagccttcttccggtcggggcgcccgtcgcaatcatcgggaaaccggga
gaagatgtttctgcgttagtcgaaatctcaaagaaatccattcccgccaaaaaggaaggt
tccgccgcgcctagccaaacttcaacctcaacacaaagcacgtcatcctcaacagctccg
acttcttccgcacaaagtggaacttctgcctcaacgtccggcgcaggcgcaggtaaaaat
ctcgaaacaaaaacaagcgtttctctttcgcagaatgccggaaacagcggcataaccgca
aacgaagaacgaacttacggattcaaaacgtcgccctcattcggcccgggagaatcggaa
cattctcctgttcgatccgcacgcggcggacgtccgatcaaagcctcccctttggcaaaa
aatctcgcccttcaaaaaggaatcaatctcacagaagtgatcggctctggtcccggagga
aggatcatcaaacgagacattctctcctatcagtcaggtggcggaaatacttttgttaag
cgacaagaccgtaagttggaaatcacgggaatgagaaagacaatcgcttcccgtcttgca
cattccacttcgaccatccctcatttttatcttacgacggaattgaatgcgggtccgatc
gacgatctcagaaactccatcaatagggatctcggactcagcggccagggaaaagtcagc
gtaaacgatctcattctcaaagcgtgttcttatactttgttgcaagtcccggaagtgaat
tcttcctggagagaagatcatatcttagagcacggaagagtcgatatcggagtcgcagtt
tccatcgaaggaggtctcattactccttatattcgaaacgcagaagagaaatccgtcctc
gaaatcagtcgagagataaaagaacttgcgtcccgggcaagagacagaaaactcaaaccg
ggggaatacacggacggcacctttaccgtctccaacctcggaatgtttggagtctcttcc
ttcaccgcggtcatcaacgaacccgaagcggcaattcttgcggtaggcgctctcgttgaa
aaaccggtgctcaaggctggaaacatcgttccgggaaaaatcttgaacgttacgctttct
tgtgatcacagagtcatagatggagcgacgggatctagatttctttccttattccgagag
tttatggagcatccccttcgcctacttacaggctaa

DBGET integrated database retrieval system