KEGG   Leptospira borgpetersenii JB197: LBJ_1968Help
Entry
LBJ_1968          CDS       T00404                                 

Definition
(GenBank) Bifunctional dihydrolipoyllysine-residue acetyltransferase/dihydrolipoyllysine-residue succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj00010  Glycolysis / Gluconeogenesis
lbj00020  Citrate cycle (TCA cycle)
lbj00620  Pyruvate metabolism
lbj01100  Metabolic pathways
lbj01110  Biosynthesis of secondary metabolites
lbj01120  Microbial metabolism in diverse environments
lbj01130  Biosynthesis of antibiotics
lbj01200  Carbon metabolism
Module
lbj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBJ_1968
   00020 Citrate cycle (TCA cycle)
    LBJ_1968
   00620 Pyruvate metabolism
    LBJ_1968
Enzymes [BR:lbj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LBJ_1968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABJ76486
UniProt: Q04RI4
Position
1:2315361..2316776
Genome map
AA seq 471 aa AA seqDB search
MAKIAEMTQLSPTMSEGKIVRWLKQKGDSVSPGEIIAEVETDKAVMEMEAFETGVLLEIL
APEGSLLPVGAPVAIIGKPGEDVSALVEISKKSIPAKKEGSAAPSQTSTSTQSTSSSTAP
TSSAQSGTSASTSGAGAGKNLETKTSVSLSQNAGNSGITANEERTYGFKTSPSFGPGESE
HSPVRSARGGRPIKASPLAKNLALQKGINLTEVIGSGPGGRIIKRDILSYQSGGGNTFVK
RQDRKLEITGMRKTIASRLAHSTSTIPHFYLTTELNAGPIDDLRNSINRDLGLSGQGKVS
VNDLILKACSYTLLQVPEVNSSWREDHILEHGRVDIGVAVSIEGGLITPYIRNAEEKSVL
EISREIKELASRARDRKLKPGEYTDGTFTVSNLGMFGVSSFTAVINEPEAAILAVGALVE
KPVLKAGNIVPGKILNVTLSCDHRVIDGATGSRFLSLFREFMEHPLRLLTG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaattgcagagatgactcaactcagtcccacgatgtcggaaggaaagatcgtc
cgatggctcaaacaaaaaggagattccgtttctcccggagaaatcatcgcggaggtggaa
acggacaaagccgtcatggaaatggaagcctttgaaaccggtgttcttttggaaattttg
gctccggaaggaagccttcttccggtcggggcgcccgtcgcaatcatcgggaaaccggga
gaagatgtttctgcgttagtcgaaatctcaaagaaatccattcccgccaaaaaggaaggt
tccgccgcgcctagccaaacttcaacctcaacacaaagcacgtcatcctcaacagctccg
acttcttccgcacaaagtggaacttctgcctcaacgtccggcgcaggcgcaggtaaaaat
ctcgaaacaaaaacaagcgtttctctttcgcagaatgccggaaacagcggcataaccgca
aacgaagaacgaacttacggattcaaaacgtcgccctcattcggcccgggagaatcggaa
cattctcctgttcgatccgcacgcggcggacgtccgatcaaagcctcccctttggcaaaa
aatctcgcccttcaaaaaggaatcaatctcacagaagtgatcggctctggtcccggagga
aggatcatcaaacgagacattctctcctatcagtcaggtggcggaaatacttttgttaag
cgacaagaccgtaagttggaaatcacgggaatgagaaagacaatcgcttcccgtcttgca
cattccacttcgaccatccctcatttttatcttacgacggaattgaatgcgggtccgatc
gacgatctcagaaactccatcaatagggatctcggactcagcggccagggaaaagtcagc
gtaaacgatctcattctcaaagcgtgttcttatactttgttgcaagtcccggaagtgaat
tcttcctggagagaagatcatatcttagagcacggaagagtcgatatcggagtcgcagtt
tccatcgaaggaggtctcattactccttatattcgaaacgcagaagagaaatccgtcctc
gaaatcagtcgagagataaaagaacttgcgtcccgggcaagagacagaaaactcaaaccg
ggggaatacacggacggcacctttaccgtctccaacctcggaatgtttggagtctcttcc
ttcaccgcggtcatcaacgaacccgaagcggcaattcttgcggtaggcgctctcgttgaa
aaaccggtgctcaaggctggaaacatcgttccgggaaaaatcttgaacgttacgctttct
tgtgatcacagagtcatagatggagcgacgggatctagatttctttccttattccgagag
tttatggagcatccccttcgcctacttacaggctaa

DBGET integrated database retrieval system