KEGG   Leptospira borgpetersenii JB197: LBJ_2125Help
Entry
LBJ_2125          CDS       T00404                                 

Gene name
aceF
Definition
bifunctional dihydrolipoyllysine-residue acetyltransferase/dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBJ_2125 (aceF)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBJ_2125 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    LBJ_2125 (aceF)
Enzymes [BR:lbj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LBJ_2125 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2515086..2516327)
Genome map
AA seq 413 aa AA seqDB search
MSVEIKVPEMGESITEATIANWVKKEGDAVKQDEILLELETDKATMEVPAPSSGVLQKIH
KKAGDTVKVKEVVGLIDSAATVSAPAPSSSSPAITTQTNQTSGNDRFNDTLPPAVRKLID
DNGLNVTAISGSGKNGQITKEDVLKAIESKTSAGVGTATAAKAASSPEIPKAVPVAKRTD
LPRENAVPMTRLRKVIAERLVSAQHNAAILTTFNEVDMSAVMELRNRYKDRFKEAHNVGL
GFMSFFTKAAIHALKTIPAINAEIRGNDVVYKNFYDIGVAVGGPKGLVVPIVRDADLLSF
AGVEQEIVRLANRVKDGKIELSEMEGGTFTISNGGIYGSMMSTPILNPPQSGILGLHNIV
KRAVVVNDQIVIRPMMYLALSYDHRIVDGKEAVTFLVKVKEAIEDPARLLLEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagaaattaaggtccccgaaatgggggaatccatcacggaagctacgattgcg
aattgggttaagaaagaaggagacgcggtaaaacaagatgagatcttgttggaactggaa
accgataaggccactatggaagttccggcgccttcttccggcgtacttcaaaaaattcat
aagaaggccggagatacagtgaaagtgaaagaggtcgtcggcctcatcgattccgcagca
accgtctccgcaccggcaccttcctcttcttctcctgcaatcacaacacaaacgaatcaa
acctcgggaaatgacagattcaatgatactcttccacctgcggttcgtaaattgatcgac
gacaacggtctgaatgttacggctatttccggttcgggtaagaacggacagatcacaaaa
gaagacgtattaaaggcgatcgaatccaaaacttccgcaggtgtgggaactgcaacggct
gcaaaagcggcgtcttctcccgaaattccgaaagcggttcctgttgcaaaaagaacggat
cttccgagagaaaatgcggtcccgatgactcgtttacgcaaagtgatcgcggaaagactc
gtatccgcgcaacacaatgccgccattttaaccacgttcaacgaagtggacatgagcgcc
gtaatggaactcagaaatcgttataaggatcgctttaaagaggcgcataacgtgggtctt
ggatttatgagtttttttacgaaagctgccatccatgctctgaaaacgattcccgcaatc
aacgcggaaatccgcggaaacgacgtcgtatataagaacttttatgatatcggggtcgct
gtcggaggaccgaaaggacttgtggtgccgatcgtaagagatgcggatcttttgagtttc
gcgggagtggagcaagagatcgtaagacttgccaaccgagttaaggacggaaagatcgaa
ctttcggagatggagggcggaacgtttacgatttccaacgggggaatctacggttccatg
atgtccactccgatcttaaaccctcctcaaagtggaattttgggacttcataatatagta
aagcgtgcggtggtggtaaacgatcaaatcgtaatccgtccgatgatgtatctcgcactt
tcctacgatcacagaatcgtagacgggaaagaagcggttacatttctcgtaaaggtcaaa
gaagcgatcgaagatccggcccgacttttactcgaactttaa

DBGET integrated database retrieval system