KEGG   Leptospira borgpetersenii JB197: LBJ_2125Help
Entry
LBJ_2125          CDS       T00404                                 

Gene name
aceF
Definition
(GenBank) Bifunctional dihydrolipoyllysine-residue acetyltransferase/dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj00020  Citrate cycle (TCA cycle)
lbj00310  Lysine degradation
lbj01100  Metabolic pathways
lbj01110  Biosynthesis of secondary metabolites
lbj01120  Microbial metabolism in diverse environments
lbj01130  Biosynthesis of antibiotics
lbj01200  Carbon metabolism
Module
lbj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lbj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBJ_2125 (aceF)
  Amino acid metabolism
   00310 Lysine degradation
    LBJ_2125 (aceF)
Enzymes [BR:lbj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LBJ_2125 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABJ76619
UniProt: Q04R51
Position
1:complement(2515086..2516327)
Genome map
AA seq 413 aa AA seqDB search
MSVEIKVPEMGESITEATIANWVKKEGDAVKQDEILLELETDKATMEVPAPSSGVLQKIH
KKAGDTVKVKEVVGLIDSAATVSAPAPSSSSPAITTQTNQTSGNDRFNDTLPPAVRKLID
DNGLNVTAISGSGKNGQITKEDVLKAIESKTSAGVGTATAAKAASSPEIPKAVPVAKRTD
LPRENAVPMTRLRKVIAERLVSAQHNAAILTTFNEVDMSAVMELRNRYKDRFKEAHNVGL
GFMSFFTKAAIHALKTIPAINAEIRGNDVVYKNFYDIGVAVGGPKGLVVPIVRDADLLSF
AGVEQEIVRLANRVKDGKIELSEMEGGTFTISNGGIYGSMMSTPILNPPQSGILGLHNIV
KRAVVVNDQIVIRPMMYLALSYDHRIVDGKEAVTFLVKVKEAIEDPARLLLEL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagaaattaaggtccccgaaatgggggaatccatcacggaagctacgattgcg
aattgggttaagaaagaaggagacgcggtaaaacaagatgagatcttgttggaactggaa
accgataaggccactatggaagttccggcgccttcttccggcgtacttcaaaaaattcat
aagaaggccggagatacagtgaaagtgaaagaggtcgtcggcctcatcgattccgcagca
accgtctccgcaccggcaccttcctcttcttctcctgcaatcacaacacaaacgaatcaa
acctcgggaaatgacagattcaatgatactcttccacctgcggttcgtaaattgatcgac
gacaacggtctgaatgttacggctatttccggttcgggtaagaacggacagatcacaaaa
gaagacgtattaaaggcgatcgaatccaaaacttccgcaggtgtgggaactgcaacggct
gcaaaagcggcgtcttctcccgaaattccgaaagcggttcctgttgcaaaaagaacggat
cttccgagagaaaatgcggtcccgatgactcgtttacgcaaagtgatcgcggaaagactc
gtatccgcgcaacacaatgccgccattttaaccacgttcaacgaagtggacatgagcgcc
gtaatggaactcagaaatcgttataaggatcgctttaaagaggcgcataacgtgggtctt
ggatttatgagtttttttacgaaagctgccatccatgctctgaaaacgattcccgcaatc
aacgcggaaatccgcggaaacgacgtcgtatataagaacttttatgatatcggggtcgct
gtcggaggaccgaaaggacttgtggtgccgatcgtaagagatgcggatcttttgagtttc
gcgggagtggagcaagagatcgtaagacttgccaaccgagttaaggacggaaagatcgaa
ctttcggagatggagggcggaacgtttacgatttccaacgggggaatctacggttccatg
atgtccactccgatcttaaaccctcctcaaagtggaattttgggacttcataatatagta
aagcgtgcggtggtggtaaacgatcaaatcgtaatccgtccgatgatgtatctcgcactt
tcctacgatcacagaatcgtagacgggaaagaagcggttacatttctcgtaaaggtcaaa
gaagcgatcgaagatccggcccgacttttactcgaactttaa

DBGET integrated database retrieval system