KEGG   Leptospira borgpetersenii JB197: LBJ_2173Help
Entry
LBJ_2173          CDS       T00404                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBJ_2173
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBJ_2173
   00052 Galactose metabolism
    LBJ_2173
   00500 Starch and sucrose metabolism
    LBJ_2173
   00520 Amino sugar and nucleotide sugar metabolism
    LBJ_2173
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LBJ_2173
   00524 Butirosin and neomycin biosynthesis
    LBJ_2173
Enzymes [BR:lbj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LBJ_2173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2578508..2579404
Genome map
AA seq 298 aa AA seqDB search
MKSYLGIDIGAGSIKASLVAEDGTILGSTSRTTGAETDETQFLDSLAGIVSEMKNSSLAA
VGIGSPGPIDCENGILIQSANLPLLKNVALVDHLKKKFSIPVYYNNDANLAALGEYRFGL
GKGSPSLVILTLGTGLGGGWVYQGKLFDGYKGSGMEAGHVTYIPNGPLCGCGQRGCTEAY
FSASGFLNRYQEKTGNSLNSAEEFFDRNRKGETVASILLNEGIEALAQLCRGLIHTINPE
KIVFTGGLVYSWDLFGNSLKERIQELIFPIFRTYTQILPGGNISGTLGAAALCMENQK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcttatctcggaatcgatatcggagcgggaagcatcaaggcgagtctagtagcc
gaggacggaaccattttaggaagtacgtcccgcacaacgggagcggaaaccgatgagact
caattcttagattcccttgccggtatcgtatcggaaatgaaaaattcctcgttagccgcg
gttggaatcggaagtcccggacccatcgactgcgaaaacggaatcctaattcaatcggca
aatctacctcttttgaaaaatgtagcgttagtcgatcatttaaaaaaaaaattttccatc
ccggtctactacaataatgacgcaaacctcgccgcacttggagaatatcgtttcggtctt
ggaaaaggatccccgagtttggtgattcttactttaggaacgggactcggaggaggctgg
gtatatcaaggaaaattatttgacggctacaaaggaagcggaatggaagcgggacacgtt
acgtatattccaaacggccccctctgcgggtgcggacaaagaggatgtacggaagcgtat
tttagcgcaagcgggttcttaaatcgatatcaggaaaaaacgggaaattccttaaactcc
gccgaagaatttttcgataggaatcgaaaaggggaaaccgtcgcatcaattttattaaac
gaaggaatcgaagccctcgcacaactctgtcggggactcattcataccattaatccggaa
aagatcgtctttacgggaggacttgtgtattcttgggatctattcggcaactcccttaaa
gaaagaattcaagaacttatctttccgattttcagaacttatacccaaattctgcccgga
ggaaacatatccggaaccttaggcgcagcggcgctttgtatggagaaccaaaaatga

DBGET integrated database retrieval system