KEGG   Leptospira borgpetersenii JB197: LBJ_2282Help
Entry
LBJ_2282          CDS       T00404                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lbj00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lbj00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lbj00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2715686..2717626
Genome map
AA seq 646 aa AA seqDB search
MKAILRYKVYENSFTSSFEISGKGTKTSSDCGNFSLSLGHKKTGKNETFKPYLEWIGEQR
PKAGTEILTLEIELPPHSLAEPKIFQQGYQSWSLSAVHSLSDADESPRLNFLRYSQENFY
TNHSGVGGDWQSEGMILLISSAKDPHYFAGAIGPGEQGVKFRVISSQRKKELENSKKKSW
IPDSGISLIYDFYRYEDFRGNKLSLTPVAVTRFTISPETYLKKYFSELGKTHKVKLPTTS
VPTGWCSWYQYYTKISEKIILKNLALVKEKKLPIQFFQIDDGYQKEIGDWLTTNDRFPGG
MRLLAEEIRREKLTPGIWLAPFLVRKKSEFYQKYPEAILKDRDGKPVPALWNPHWGMDYT
YCVDVTHPTSRDFLENILKTIVKDNGYQYLKLDFLYAALLPGWTYDRNISPHKRYVDTIR
FVRKVVGKDVFLLGCGAPIYPSIGLFDAMRIGCDVAPFWEREKTRILAKDKHALSTERAL
INDITRSSMHRNLWYNDPDCLLVRESKNHMTYAQTQLMASVMAVSGGMIFVSDDLSRVGE
ERLALLKKTLELGVKCRSKTPVPIGFASGSFPSALYNPAGFLGIWNPREEESTIEIQVPF
ISKLKQFPDYWTGKVPESLEYFSRSGVLKLKLPAYGSVVLQTAKVV
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccattttaagatataaagtctatgagaattcctttacatcctcatttgaaatt
tccggcaaaggaaccaaaacttccagcgactgtggaaatttttccctttcccttggtcat
aaaaaaacggggaagaacgaaacattcaaaccgtatctcgaatggatcggagaacaaaga
cccaaagccggaaccgaaattctcaccctggaaatagaacttccaccgcactcgttggca
gaaccgaagatcttccaacaaggttatcaatcctggagtctttccgccgttcactccctt
tccgacgcggatgaatctccgaggttgaatttccttcgatattctcaggagaatttctat
acgaatcattccggtgtcggaggagattggcagagtgaagggatgattcttctgatttct
tccgcaaaggatccgcattattttgcgggagcaattggtcccggagaacaaggagtaaaa
ttcagagtcatttcctctcaaagaaaaaaggaactggagaactccaaaaaaaaatcctgg
attcccgattccggaatttccttgatctacgacttctatcgttacgaggatttcagaggg
aataaactttccctcactcccgtcgcagtaacccgttttaccataagcccggaaacatat
ttaaaaaagtattttagtgaattaggaaaaactcataaagtaaaacttcccacaacatct
gttccgaccggatggtgttcctggtaccaatactacactaaaatttccgaaaagatcatt
ttgaaaaatctcgctcttgtaaaagagaaaaaactcccgattcaattctttcagatcgac
gacggttatcaaaaagagatcggggattggctgaccacgaacgatcggtttcccggagga
atgagacttttagccgaagaaatccgaagggaaaaattgactccggggatttggctcgca
ccctttctcgtccgaaaaaaatccgaattctatcagaaatatcccgaagctatcctcaaa
gatcgggacggaaagcccgtgcctgcactttggaatcctcactggggaatggactacacc
tactgcgtcgacgtaactcatcccacctcccgagatttcctagagaacatcctaaaaacg
attgtaaaagacaacggatatcagtatctcaaactagacttcttatacgccgcccttctt
cccggttggacttacgatcggaatatctcgcctcacaaacgttatgtggatacgattcgg
ttcgtccgtaaagtcgtcggtaaagatgtgttcctccttggatgtggagcgcccatctat
ccgtcgatcggactgttcgatgcgatgagaatcggttgtgacgtggcgcctttctgggaa
agagaaaaaacgagaattctcgcaaaggacaaacatgcgctcagtaccgaaagagccttg
attaacgacattactcgctcttcgatgcacagaaacttatggtacaacgatccggattgc
cttttggttcgagaaagtaaaaatcatatgacatacgcacaaactcaattgatggcgagc
gtaatggcggtgagcggcggaatgattttcgtaagcgacgatttgtcccgagtcggagaa
gaaagactcgcgcttttaaagaaaacattagaactcggagtcaagtgcagaagtaaaact
ccagttccgatcggattcgcttccggttcgtttccatccgcgctttacaatccggcaggc
tttttaggaatttggaatccaagagaagaagaaagtacgatcgaaatccaagttcctttc
atctctaaactcaaacaatttccggattattggacaggaaaagttcccgaatccctcgag
tatttttcaagaagtggagttctcaaattaaaacttccggcatacggttccgtggtatta
caaaccgcaaaagttgtttga

DBGET integrated database retrieval system