KEGG   Leptospira borgpetersenii JB197: LBJ_2282Help
Entry
LBJ_2282          CDS       T00404                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj00052  Galactose metabolism
lbj00561  Glycerolipid metabolism
lbj00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LBJ_2282
  Lipid metabolism
   00561 Glycerolipid metabolism
    LBJ_2282
   00600 Sphingolipid metabolism
    LBJ_2282
Enzymes [BR:lbj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LBJ_2282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Raffinose_syn Glyco_hydro_31
Motif
Other DBs
NCBI-ProteinID: ABJ76756
UniProt: Q04QR4
Position
1:2715686..2717626
Genome map
AA seq 646 aa AA seqDB search
MKAILRYKVYENSFTSSFEISGKGTKTSSDCGNFSLSLGHKKTGKNETFKPYLEWIGEQR
PKAGTEILTLEIELPPHSLAEPKIFQQGYQSWSLSAVHSLSDADESPRLNFLRYSQENFY
TNHSGVGGDWQSEGMILLISSAKDPHYFAGAIGPGEQGVKFRVISSQRKKELENSKKKSW
IPDSGISLIYDFYRYEDFRGNKLSLTPVAVTRFTISPETYLKKYFSELGKTHKVKLPTTS
VPTGWCSWYQYYTKISEKIILKNLALVKEKKLPIQFFQIDDGYQKEIGDWLTTNDRFPGG
MRLLAEEIRREKLTPGIWLAPFLVRKKSEFYQKYPEAILKDRDGKPVPALWNPHWGMDYT
YCVDVTHPTSRDFLENILKTIVKDNGYQYLKLDFLYAALLPGWTYDRNISPHKRYVDTIR
FVRKVVGKDVFLLGCGAPIYPSIGLFDAMRIGCDVAPFWEREKTRILAKDKHALSTERAL
INDITRSSMHRNLWYNDPDCLLVRESKNHMTYAQTQLMASVMAVSGGMIFVSDDLSRVGE
ERLALLKKTLELGVKCRSKTPVPIGFASGSFPSALYNPAGFLGIWNPREEESTIEIQVPF
ISKLKQFPDYWTGKVPESLEYFSRSGVLKLKLPAYGSVVLQTAKVV
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccattttaagatataaagtctatgagaattcctttacatcctcatttgaaatt
tccggcaaaggaaccaaaacttccagcgactgtggaaatttttccctttcccttggtcat
aaaaaaacggggaagaacgaaacattcaaaccgtatctcgaatggatcggagaacaaaga
cccaaagccggaaccgaaattctcaccctggaaatagaacttccaccgcactcgttggca
gaaccgaagatcttccaacaaggttatcaatcctggagtctttccgccgttcactccctt
tccgacgcggatgaatctccgaggttgaatttccttcgatattctcaggagaatttctat
acgaatcattccggtgtcggaggagattggcagagtgaagggatgattcttctgatttct
tccgcaaaggatccgcattattttgcgggagcaattggtcccggagaacaaggagtaaaa
ttcagagtcatttcctctcaaagaaaaaaggaactggagaactccaaaaaaaaatcctgg
attcccgattccggaatttccttgatctacgacttctatcgttacgaggatttcagaggg
aataaactttccctcactcccgtcgcagtaacccgttttaccataagcccggaaacatat
ttaaaaaagtattttagtgaattaggaaaaactcataaagtaaaacttcccacaacatct
gttccgaccggatggtgttcctggtaccaatactacactaaaatttccgaaaagatcatt
ttgaaaaatctcgctcttgtaaaagagaaaaaactcccgattcaattctttcagatcgac
gacggttatcaaaaagagatcggggattggctgaccacgaacgatcggtttcccggagga
atgagacttttagccgaagaaatccgaagggaaaaattgactccggggatttggctcgca
ccctttctcgtccgaaaaaaatccgaattctatcagaaatatcccgaagctatcctcaaa
gatcgggacggaaagcccgtgcctgcactttggaatcctcactggggaatggactacacc
tactgcgtcgacgtaactcatcccacctcccgagatttcctagagaacatcctaaaaacg
attgtaaaagacaacggatatcagtatctcaaactagacttcttatacgccgcccttctt
cccggttggacttacgatcggaatatctcgcctcacaaacgttatgtggatacgattcgg
ttcgtccgtaaagtcgtcggtaaagatgtgttcctccttggatgtggagcgcccatctat
ccgtcgatcggactgttcgatgcgatgagaatcggttgtgacgtggcgcctttctgggaa
agagaaaaaacgagaattctcgcaaaggacaaacatgcgctcagtaccgaaagagccttg
attaacgacattactcgctcttcgatgcacagaaacttatggtacaacgatccggattgc
cttttggttcgagaaagtaaaaatcatatgacatacgcacaaactcaattgatggcgagc
gtaatggcggtgagcggcggaatgattttcgtaagcgacgatttgtcccgagtcggagaa
gaaagactcgcgcttttaaagaaaacattagaactcggagtcaagtgcagaagtaaaact
ccagttccgatcggattcgcttccggttcgtttccatccgcgctttacaatccggcaggc
tttttaggaatttggaatccaagagaagaagaaagtacgatcgaaatccaagttcctttc
atctctaaactcaaacaatttccggattattggacaggaaaagttcccgaatccctcgag
tatttttcaagaagtggagttctcaaattaaaacttccggcatacggttccgtggtatta
caaaccgcaaaagttgtttga

DBGET integrated database retrieval system