KEGG   Leptospira borgpetersenii JB197: LBJ_2359Help
Entry
LBJ_2359          CDS       T00404                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LBJ_2359
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBJ_2359
  Lipid metabolism
   00071 Fatty acid degradation
    LBJ_2359
  Amino acid metabolism
   00350 Tyrosine metabolism
    LBJ_2359
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LBJ_2359
   00626 Naphthalene degradation
    LBJ_2359
Enzymes [BR:lbj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LBJ_2359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2822274..2823308
Genome map
AA seq 344 aa AA seqDB search
MKAAILESGKKILDIREVPVPELKPGQVKVKIKACGICGSDVHLVIHGTLKCKHFPRIPG
HESSGIIEEVGENVSRFQKGDRVVIAAGTSCGVCSYCKAGYENLCKDVGVFGFDRDGGFA
EYNIAEERYLYSLPDTIPFDQGAILADAVSTPYHAIRYRGNIQNGDTVAIFGCGGLGIHA
VAIARAMTDGKVIALDVERGPLENAAKYGADEIINLKEIRNPGKTLKEITKGVDLLADFS
GYMSNIEESLRAMNPGGRIVLVGIGRQPLKFQIPFILIGRMISVLGSYGSDRRAIPELIE
LYLKGKINLSHSITSHHTLEELNQCLEDLDERKGNPIRFIIQPG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcaattttagaatccggtaaaaaaatcttagacatcagagaagttccagtt
ccagaactcaaacccggacaagtaaaagtaaaaatcaaagcctgcggaatttgcggatcc
gatgtccatctcgtgatccacggtactctcaaatgtaaacattttccaagaattcccggc
cacgaatcgtcgggaataatcgaggaagtaggtgaaaacgtaagtcgttttcaaaaagga
gatcgtgtcgtaatcgctgccggaacctcctgcggagtttgttcttactgcaaagcggga
tacgaaaacttatgtaaagacgtaggagttttcggttttgatcgagacggaggttttgcg
gaatataatatcgcggaagaacgttatttgtattctcttccggatacgattccgttcgat
caaggagcaattcttgcagacgcggtttccacaccgtatcacgcgattcgatacagagga
aatattcaaaacggtgatacggttgccatattcggttgcggcggccttggaatccatgcg
gtcgcgattgcaagagctatgaccgacggaaaagtaatcgctttagacgtggaaagagga
ccattggaaaatgcggctaagtacggagccgatgaaatcatcaatttgaaagaaattcga
aacccgggaaaaactctcaaagaaattacaaagggagtggatctacttgcggatttttcg
ggatatatgtccaacattgaagaatctctacgcgctatgaatcccggaggtagaatcgtt
ctcgtgggaatcggaagacaacctttgaagtttcagattccttttattttaatcgggaga
atgatttcagtcttgggttcgtacggttccgatcgtagggcaattcccgaactgatcgaa
ttataccttaaagggaaaatcaatctttctcattcgatcacttcccatcatacattagag
gaattgaatcaatgcctggaagacttggacgaaagaaaaggaaatccgattcggtttatc
attcaacctggatga

DBGET integrated database retrieval system