KEGG   Leptospira borgpetersenii JB197: LBJ_2549Help
Entry
LBJ_2549          CDS       T00404                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj00260  Glycine, serine and threonine metabolism
lbj00750  Vitamin B6 metabolism
lbj01100  Metabolic pathways
lbj01110  Biosynthesis of secondary metabolites
lbj01120  Microbial metabolism in diverse environments
lbj01230  Biosynthesis of amino acids
Module
lbj_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBJ_2549 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LBJ_2549 (thrC)
Enzymes [BR:lbj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LBJ_2549 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABJ76978
UniProt: Q04Q42
Position
1:complement(3049096..3050439)
Genome map
AA seq 447 aa AA seqDB search
MISTLTRYKAEFECINDSCKTRYDLNEIVYECKKCGSLLQVSHDLEALGTVSGKEWKDRF
DSRFRSVKFPNSSGIWNKREWVLPHIEDKNIVTSGEGLTHLFTSDRLTESLGLGNFYVKQ
CGISHTGSFKDLGMTVLLSQVKHMITSGVPIHAVACASSGDTSAALASYAAKAGIPAIIF
LPAGKVSQAQLIQPVSNGAKVIALDTDFDGCMQIVKEVTREAGIYLANSMNSLRIEGQKT
ISVEIVQQLEWKVPDWIVIPGGNLGNVSALGAGFEMMFSLGLVDKLPRIALAQAEHANPL
YLSYLKNFESFEPVVAKTTLASAIQIGNPVSIQKAIKTLKKFNGVVEQANESELANAAAK
ADLFGLYNDPHTGVALATLEKLIQKGTIAKGESVVVISTAHGLKFTEFKLQFHDGKIPQV
DSTVVNSIHRIEPNATKVIDLIRKLLF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgatctccactcttacccggtacaaagcggaatttgaatgtattaacgactcttgcaaa
actcggtacgatctgaacgagatcgtctacgaatgtaaaaaatgcggaagtcttctccaa
gtatcacatgacttggaggcgttgggaaccgtatcgggaaaagagtggaaagatcgattc
gattccagatttcgttccgtaaagtttccgaattcttccggaatttggaataaaagagaa
tgggttcttcctcatatcgaagataagaatatcgtaacctccggggaagggctcactcat
ctttttacttccgatcgattgactgaaagtctcgggctcggaaatttttacgtaaaacaa
tgcgggatttcgcacacgggttcgttcaaagatctcggaatgaccgttttattatcccaa
gtaaaacatatgatcacgtccggcgttccgattcatgcggtggcttgtgcaagttccgga
gatacttccgctgcacttgcgtcttacgcggcaaaggcgggaataccagcgattatattt
ttgcctgcgggaaaggtatcgcaagcgcagttgatccagccggtatcgaacggagccaag
gtaatcgcactcgacacggattttgacggatgtatgcaaattgtcaaagaagtgacgagg
gaagcgggaatttatcttgcaaactcgatgaattctttacggatcgaagggcaaaaaacg
atttccgttgaaattgtgcaacagttggaatggaaggttccggattggatcgtgattccg
ggaggcaatcttggaaacgtatccgcgcttggagctggatttgagatgatgttttctttg
gggcttgtcgataaacttcctaggatcgctttagcccaagcggaacatgcgaatccgtta
tatctttcttacttaaagaattttgaaagtttcgaaccggttgtcgctaagactacgctt
gcgtccgcgattcaaatcggaaatccggtttccatccaaaaggcgattaaaactctcaag
aagttcaatggagtcgtggaacaggctaatgagtcggaattggcgaatgcggcagcaaag
gcggacttattcggtttatacaatgatcctcatacgggagtggctctggcgactttggaa
aagctgatccaaaaaggaacgatcgctaaaggggagagtgtggtcgttatttcgaccgct
cacggattgaagttcaccgaattcaaacttcagttccacgacggaaaaattccgcaagta
gattctacggtcgtgaattccattcatcgaattgaaccgaatgcgacaaaagtcatcgac
ttaatccggaaattgttgttctag

DBGET integrated database retrieval system