KEGG   Leptospira borgpetersenii JB197: LBJ_2549Help
Entry
LBJ_2549          CDS       T00404                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LBJ_2549 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBJ_2549 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LBJ_2549 (thrC)
Enzymes [BR:lbj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LBJ_2549 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3049096..3050439)
Genome map
AA seq 447 aa AA seqDB search
MISTLTRYKAEFECINDSCKTRYDLNEIVYECKKCGSLLQVSHDLEALGTVSGKEWKDRF
DSRFRSVKFPNSSGIWNKREWVLPHIEDKNIVTSGEGLTHLFTSDRLTESLGLGNFYVKQ
CGISHTGSFKDLGMTVLLSQVKHMITSGVPIHAVACASSGDTSAALASYAAKAGIPAIIF
LPAGKVSQAQLIQPVSNGAKVIALDTDFDGCMQIVKEVTREAGIYLANSMNSLRIEGQKT
ISVEIVQQLEWKVPDWIVIPGGNLGNVSALGAGFEMMFSLGLVDKLPRIALAQAEHANPL
YLSYLKNFESFEPVVAKTTLASAIQIGNPVSIQKAIKTLKKFNGVVEQANESELANAAAK
ADLFGLYNDPHTGVALATLEKLIQKGTIAKGESVVVISTAHGLKFTEFKLQFHDGKIPQV
DSTVVNSIHRIEPNATKVIDLIRKLLF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgatctccactcttacccggtacaaagcggaatttgaatgtattaacgactcttgcaaa
actcggtacgatctgaacgagatcgtctacgaatgtaaaaaatgcggaagtcttctccaa
gtatcacatgacttggaggcgttgggaaccgtatcgggaaaagagtggaaagatcgattc
gattccagatttcgttccgtaaagtttccgaattcttccggaatttggaataaaagagaa
tgggttcttcctcatatcgaagataagaatatcgtaacctccggggaagggctcactcat
ctttttacttccgatcgattgactgaaagtctcgggctcggaaatttttacgtaaaacaa
tgcgggatttcgcacacgggttcgttcaaagatctcggaatgaccgttttattatcccaa
gtaaaacatatgatcacgtccggcgttccgattcatgcggtggcttgtgcaagttccgga
gatacttccgctgcacttgcgtcttacgcggcaaaggcgggaataccagcgattatattt
ttgcctgcgggaaaggtatcgcaagcgcagttgatccagccggtatcgaacggagccaag
gtaatcgcactcgacacggattttgacggatgtatgcaaattgtcaaagaagtgacgagg
gaagcgggaatttatcttgcaaactcgatgaattctttacggatcgaagggcaaaaaacg
atttccgttgaaattgtgcaacagttggaatggaaggttccggattggatcgtgattccg
ggaggcaatcttggaaacgtatccgcgcttggagctggatttgagatgatgttttctttg
gggcttgtcgataaacttcctaggatcgctttagcccaagcggaacatgcgaatccgtta
tatctttcttacttaaagaattttgaaagtttcgaaccggttgtcgctaagactacgctt
gcgtccgcgattcaaatcggaaatccggtttccatccaaaaggcgattaaaactctcaag
aagttcaatggagtcgtggaacaggctaatgagtcggaattggcgaatgcggcagcaaag
gcggacttattcggtttatacaatgatcctcatacgggagtggctctggcgactttggaa
aagctgatccaaaaaggaacgatcgctaaaggggagagtgtggtcgttatttcgaccgct
cacggattgaagttcaccgaattcaaacttcagttccacgacggaaaaattccgcaagta
gattctacggtcgtgaattccattcatcgaattgaaccgaatgcgacaaaagtcatcgac
ttaatccggaaattgttgttctag

DBGET integrated database retrieval system