KEGG   Leptospira borgpetersenii JB197: LBJ_2584Help
Entry
LBJ_2584          CDS       T00404                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj00900  Terpenoid backbone biosynthesis
lbj01100  Metabolic pathways
lbj01110  Biosynthesis of secondary metabolites
lbj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBJ_2584 (ispE)
Enzymes [BR:lbj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LBJ_2584 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABJ77012
UniProt: Q04Q08
Position
1:3093438..3094331
Genome map
AA seq 297 aa AA seqDB search
MISPAKINLGLEIPFKRPDGFHEIRSIFLKISWGDDIEIEPADNGVFELFSENEIILEKR
KLYDQVSEIGDIKKNILYKTFIKARSLFPELPGVKIHLTKRISPAGGLGGGSTNAASLLN
FLFSWRSFFTSDEMRVFATEIGSDVPFFLGEGHAFVTGKGEISEEIEVHPGQGILALTPQ
VMNTAEMYTLLKKPLQESASQKNGNTLSESLISVLKSGDWRSLQGRLLNDFEPVAFQLHP
ELGVLKDKFLEFGSSYCSLTGSGSSMYGLVQGLEIQEELLHRLRQEFSNLTFVRFNF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttgatttctccggctaaaatcaatctcggtttggaaattccgtttaaacgtccggacggg
tttcatgaaattcgaagtatatttctaaaaatctcttggggagacgatatcgaaattgaa
ccagcggataacggagttttcgaacttttttctgaaaacgaaatcatattagaaaaacga
aaactatacgatcaggtttcagagataggcgacatcaaaaaaaatattctttataaaact
tttataaaggcaagatccctttttccggaacttccaggagtaaaaatccatcttacaaaa
agaatttctccggctgggggcctcggaggaggaagtacaaacgcggcttctttattaaac
tttcttttttcttggcgttccttttttacctccgacgaaatgcgcgtatttgcgaccgaa
atcggttcggatgttccttttttcctaggagaaggacatgcattcgttaccggaaaggga
gaaatttcggaagagatcgaggttcatcccggccaaggaatccttgctttaactccgcaa
gtgatgaatacggcggaaatgtataccttgttgaaaaaacctttacaagagagtgcttct
cagaaaaatggaaacactctgtcggaaagtctgatttctgttctaaaaagcggagactgg
agatctctacagggtaggctcttgaatgattttgagccggttgccttccaacttcatccg
gaattgggagttctcaaggacaaattcctggagtttggatccagttattgttctttgacc
ggttcaggttcaagtatgtacgggctggttcagggccttgagatccaagaagaactgttg
cacagactgaggcaggaattctcaaatctcacattcgtacgatttaatttttag

DBGET integrated database retrieval system