KEGG   Leptospira borgpetersenii JB197: LBJ_2677Help
Entry
LBJ_2677          CDS       T00404                                 

Definition
L-isoaspartate protein carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lbj  Leptospira borgpetersenii JB197
Brite
Enzymes [BR:lbj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     LBJ_2677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3184053..3184718)
Genome map
AA seq 221 aa AA seqDB search
MSFSSKICNPILREKERKNMVDFQIVSRGIRNKKVLSAMRSIPRECFVPDSHVSQAYDDK
PLPIGYHQTISQPFMVAWMSLLLEIRKGDRIFEIGTGSGYQSAVLIFLGAKLFSVEFFES
LHKIAIQNLELWNPGCTRTNRFVSGNATQVLKPELQFDKMISCAALPDLPGVESSYFHSL
VPGGFFIFPMGKKKQFLITARRNWNDWSFESKCEVKFVPLL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttcatctaagatttgtaatccgattcttcgtgaaaaagagagaaagaatatg
gtcgatttccaaatcgtttctcgaggaattcgtaataaaaaagttctctctgcgatgcgt
tcgattccaagagaatgttttgtacctgattcccacgtttcgcaagcgtatgacgacaaa
cctttaccgatcggatatcatcaaacgatttcacaaccgttcatggtcgcatggatgtct
ctgcttcttgaaattcgaaagggcgatcgaattttcgaaatcggtaccggctccggttat
caaagcgccgttttaatttttcttggagcgaagttattctccgttgagttctttgaatct
cttcataaaatcgcgattcaaaatttagaactctggaatccgggttgtactcgaacaaac
cgttttgttagcggaaatgcaactcaagttctcaaacctgaacttcaatttgataagatg
atttcctgcgccgctcttcccgatcttcccggcgtggaaagttcctactttcactccctg
gtcccgggaggtttttttatttttcctatgggaaagaaaaaacaatttttaataaccgca
agaaggaattggaacgattggtcttttgaatctaagtgtgaagtgaaattcgttccctta
ctttaa

DBGET integrated database retrieval system