KEGG   Leptospira borgpetersenii JB197: LBJ_2918Help
Entry
LBJ_2918          CDS       T00404                                 

Gene name
phoD
Definition
phosphodiesterase I
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LBJ_2918 (phoD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LBJ_2918 (phoD)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LBJ_2918 (phoD)
Enzymes [BR:lbj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LBJ_2918 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3460775..3462103
Genome map
AA seq 442 aa AA seqDB search
MKFKILKHKRVLYYLLLIFNLQLNAEAAKIVSGPILGYSTLKEVLVWIQTDQASKVALEY
SEIGNPRNRYISETIQTDYKTGFIAKLIANRVEPGKSYNYNLLVDGKRIKGEHPQTFQAQ
SFFAYASHQDPPSFSFALGSCAYVNESEFDVPGKPYGGEYFIFNSILSKKPNFMLWLGDN
IYLREPDWDSRTGFLHRYRHQRGIPELAPLFASVHHYAIWDDHDFGPNDSDSSFWMRETS
EEMFKLHWGNPNYAKEGIYGSFVWGDVQFFLLDNRTFRTANNNREIGPRQILGEKQFQWF
VNSLAYSKATFKFVAIGGQFLNPNSVFENHATYPQERNKILSAIRDLKIKNLIFLTGDRH
HTELNFLQEDDISIYDFTVSPLTSRYYSPSEKNPLRVEGTLVDKRNFGTISVSGKRGQRK
LVLQIFDVYGKELWKKEILPTP
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaaaattctaaaacacaaaagagttctttattatcttctattgatttttaat
cttcaactaaatgcagaggcagccaaaattgtctctggaccgattttgggatattccaca
ttaaaggaagttttagtctggattcaaactgatcaggcttccaaagttgcattagaatat
tctgaaattggaaatcctaggaataggtatatttccgaaacaatacaaacggattataaa
acgggctttatcgcaaaattgatcgcaaaccgcgtcgaacctggcaaaagttataattac
aatctactcgtagacggaaaaagaattaaaggggaacacccgcagacatttcaggcacaa
tcattttttgcctatgcgtcccatcaagatccgccttcattctcgttcgcgcttggaagt
tgcgcttatgtcaatgaaagtgaatttgatgtccctggaaaaccttatggcggtgaatac
tttatctttaactctatcctttccaaaaaaccgaattttatgctctggctcggagacaac
atctatctgagggaaccggattgggattcaagaaccggtttcctgcatcgttataggcat
cagcgtggaattccagaacttgctccgctttttgcatcggtccatcactatgcgatttgg
gacgatcatgatttcggtccgaacgactcggattcttccttttggatgagagaaacttcg
gaagaaatgttcaaacttcattggggaaatccgaattatgcaaaagaaggtatctacggc
tctttcgtttggggagacgttcaattttttcttttggataatcgaacatttagaacggca
aataacaaccgggaaatcggcccgagacaaattctgggagaaaaacaatttcagtggttt
gtaaattctttagcatattcaaaagccacatttaagttcgtcgcgatcggcggacaattt
ttaaacccgaactccgtttttgaaaaccacgccacatatcctcaagaaagaaataaaatc
ctttccgcgattcgagatttaaaaattaaaaatctgatttttctcacgggtgatcgccat
catacggagttgaactttcttcaggaagacgacatatcgatttacgatttcaccgtttca
ccattaacttccagatattattccccttctgaaaaaaatcctttacgggtggaaggaacc
cttgttgataaaagaaattttggaacgatttccgtaagcgggaaacgaggtcaaagaaaa
cttgttctacagatttttgacgtatatggaaaagagctttggaaaaaagaaatccttcca
accccttaa

DBGET integrated database retrieval system