KEGG   Leptospira borgpetersenii JB197: LBJ_4010Help
Entry
LBJ_4010          CDS       T00404                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LBJ_4010 (hemB)
Enzymes [BR:lbj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     LBJ_4010 (hemB)
Exosome [BR:lbj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBJ_4010 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:11511..12464
Genome map
AA seq 317 aa AA seqDB search
METKQRRIRLNVGLRDLASSESLNSKKLIQPLFIAEGLKEKEKMDSLPGVYRDTEVSVLK
QVESDLKAGVTHFILFLVPKSKSNSEIPKSFYERSISSLKKEFPDAFLWIDTCMCSLTTH
GHCGLLRPDGSVDNPSSVKHLSEIALTYAQSGADGIAPSDMMDGRIKSHRSVLDKNGFSN
IPILSYSTKFKSNFYGPFRAAADSAPGHGDRSSYQIDVRNREDSILSSVRDKEEGADFLM
VKPGMTSIDLIGPIREKTGLPVGAYQVSGEYASIHYLAQNGFCDFNAALCETWQIFSRAR
ASYLITYGARKGKEILS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaccaaacaaagaagaattcgccttaatgtaggactcagagatcttgcgtcttcg
gagagtctgaattcaaaaaaactaatacaacctctttttatcgcagaaggtttaaaagaa
aaagagaagatggattctcttccgggtgtttacagggacaccgaggtttccgtcttaaaa
caagtagagtcggatctcaaagcgggagtgactcattttattctttttctcgttccaaag
tccaaatccaattctgaaattccgaaatctttttacgaacgttccatctcttccttgaaa
aaggaatttcccgacgcgtttttatggatcgatacttgtatgtgttcactcacgactcac
ggccattgtggccttctgcgtccggacggaagcgtcgataacccctcttccgtaaaacat
ctttccgagatcgctttgacatatgcacagtccggtgcggatggaatcgctccgagtgat
atgatggacggaagaatcaaaagtcaccgttccgttttagataaaaacggtttttcgaat
attccaattttaagttattctactaagtttaagagcaatttttacgggccgtttcgtgcg
gcggcggattccgctccggggcacggggatcgttcttcctaccagatagacgttcggaat
cgagaggattcgattctttcctccgtgcgcgataaagaagaaggcgccgattttttaatg
gtcaaacccgggatgacttctatcgatcttatcggtccgattcgggaaaaaaccggactt
ccggtaggcgcttatcaggtcagcggagaatacgcgtcgattcactatcttgcacaaaac
ggtttttgtgattttaacgcggctttgtgcgagacctggcagattttttctagagcgaga
gcctcttatttaataacttatggagcaagaaaaggtaaggagattttatcttga

DBGET integrated database retrieval system