KEGG   Leptospira borgpetersenii JB197: LBJ_4094Help
Entry
LBJ_4094          CDS       T00404                                 

Gene name
pfkA
Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LBJ_4094 (pfkA)
   01230 Biosynthesis of amino acids
    LBJ_4094 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBJ_4094 (pfkA)
   00030 Pentose phosphate pathway
    LBJ_4094 (pfkA)
   00051 Fructose and mannose metabolism
    LBJ_4094 (pfkA)
   00052 Galactose metabolism
    LBJ_4094 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LBJ_4094 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LBJ_4094 (pfkA)
Enzymes [BR:lbj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LBJ_4094 (pfkA)
Protein phosphatases and associated proteins [BR:lbj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LBJ_4094 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:107692..109026
Genome map
AA seq 444 aa AA seqDB search
METRIQNFGQCSISSPANYEYYTSDSSRLIFKTVFQSEEDWNSYVKGNPDFFEQAGPREK
IYFSPKEVTAGIVTCGGLCPGINDVIRGIVMELYYRYGVSRILGFPYGYQGLVKKYSYEP
IELTPEKVAHIADEGGSMLSSSRGNQSPVEMVDCLGFYGVKMLFCIGGDGTLRGAREIVN
EVARRKMEISVIGIPKTIDNDINYVQKTFGFSTAFSKAMEAVECGHVEAKGAPNGIGLVK
LMGRHSGFIAVNAALASKNVNYCLIPEVNFDLYGNGAFLDDLKKRIQKKGHAVIIVAEGA
GQKFFDSTEERDPSGNLKLGDIGLFLKDTMTEFFKKENIPVNIKYIDPSYIIRSIPANAE
DSVFCGFLAQNAVHAAMAGKTDMVVGMWNNVFIHLPISLAIQERKVLQPDKSTLWRSLLA
STGQPAHMLAKHSEDRNVNYVRII
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacgaattcaaaattttggtcaatgttcgatatctagtcccgcgaattatgaa
tattacacgagtgattcctccaggttgatatttaaaactgtgtttcaatcggaagaggat
tggaattcttatgtgaaaggtaatcccgattttttcgaacaggctggacctagggaaaaa
atatatttttctcccaaagaagtgaccgccggaatcgtaacttgcggaggtttgtgcccc
ggaatcaacgacgtgattcgagggatagtaatggagctttattatcgttacggagtttcc
aggattttaggttttccctacggctaccaagggcttgtaaaaaaatattcttacgaaccg
attgaactcacgcctgaaaaagtggcgcatattgcggatgaaggcgggtctatgctctct
tcgtccagaggaaatcaatctccggtcgaaatggtggattgtctcggcttttacggagta
aagatgcttttttgtattggaggagacggcactcttcgaggcgctcgggagatcgtgaat
gaggtcgcgagaagaaagatggaaatttctgtcattggaattccgaagacgatcgacaac
gatatcaactacgtacaaaaaacattcggtttttctactgcgttttccaaggcgatggaa
gcggtggaatgtggacatgtggaagcgaaaggagcgccgaacggaatcggcttggtcaaa
ctgatgggacgtcattccggattcatcgcggtaaatgcggctctcgcttctaaaaacgta
aattattgcctaattcccgaagtgaattttgacctctatggaaatggagcgtttttggac
gatctcaaaaaaagaatccaaaagaagggacacgcggttatcatcgtggcggaaggagcc
gggcagaaatttttcgattcgacggaagaaagagacccttccgggaatctgaaactgggg
gatattggtcttttcctcaaggatacgatgactgagtttttcaaaaaagaaaacattcca
gtgaacatcaaatacatagatccgagttatatcattcgatcgattccggctaacgcggaa
gattccgtattctgtggttttttggctcaaaacgcggttcacgcggcaatggccggtaaa
accgatatggttgtgggaatgtggaacaacgtgttcatacatcttccgatttctcttgcg
attcaggaaagaaaagtgttgcaaccggacaaaagtactctttggagatctcttttggct
tccacgggtcagcccgcgcatatgttggccaaacattcagaggacagaaatgtaaattac
gtcagaatcatttga

DBGET integrated database retrieval system