KEGG   Leptospira borgpetersenii JB197: LBJ_4094Help
Entry
LBJ_4094          CDS       T00404                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj00010  Glycolysis / Gluconeogenesis
lbj00030  Pentose phosphate pathway
lbj00051  Fructose and mannose metabolism
lbj00052  Galactose metabolism
lbj00680  Methane metabolism
lbj01100  Metabolic pathways
lbj01110  Biosynthesis of secondary metabolites
lbj01120  Microbial metabolism in diverse environments
lbj01130  Biosynthesis of antibiotics
lbj01200  Carbon metabolism
lbj01230  Biosynthesis of amino acids
lbj03018  RNA degradation
Module
lbj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lbj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBJ_4094 (pfkA)
   00030 Pentose phosphate pathway
    LBJ_4094 (pfkA)
   00051 Fructose and mannose metabolism
    LBJ_4094 (pfkA)
   00052 Galactose metabolism
    LBJ_4094 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LBJ_4094 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LBJ_4094 (pfkA)
Enzymes [BR:lbj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LBJ_4094 (pfkA)
Protein phosphatases and associated proteins [BR:lbj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LBJ_4094 (pfkA)
Messenger RNA biogenesis [BR:lbj03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LBJ_4094 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABJ77489
UniProt: Q04NN1
Position
2:107692..109026
Genome map
AA seq 444 aa AA seqDB search
METRIQNFGQCSISSPANYEYYTSDSSRLIFKTVFQSEEDWNSYVKGNPDFFEQAGPREK
IYFSPKEVTAGIVTCGGLCPGINDVIRGIVMELYYRYGVSRILGFPYGYQGLVKKYSYEP
IELTPEKVAHIADEGGSMLSSSRGNQSPVEMVDCLGFYGVKMLFCIGGDGTLRGAREIVN
EVARRKMEISVIGIPKTIDNDINYVQKTFGFSTAFSKAMEAVECGHVEAKGAPNGIGLVK
LMGRHSGFIAVNAALASKNVNYCLIPEVNFDLYGNGAFLDDLKKRIQKKGHAVIIVAEGA
GQKFFDSTEERDPSGNLKLGDIGLFLKDTMTEFFKKENIPVNIKYIDPSYIIRSIPANAE
DSVFCGFLAQNAVHAAMAGKTDMVVGMWNNVFIHLPISLAIQERKVLQPDKSTLWRSLLA
STGQPAHMLAKHSEDRNVNYVRII
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacgaattcaaaattttggtcaatgttcgatatctagtcccgcgaattatgaa
tattacacgagtgattcctccaggttgatatttaaaactgtgtttcaatcggaagaggat
tggaattcttatgtgaaaggtaatcccgattttttcgaacaggctggacctagggaaaaa
atatatttttctcccaaagaagtgaccgccggaatcgtaacttgcggaggtttgtgcccc
ggaatcaacgacgtgattcgagggatagtaatggagctttattatcgttacggagtttcc
aggattttaggttttccctacggctaccaagggcttgtaaaaaaatattcttacgaaccg
attgaactcacgcctgaaaaagtggcgcatattgcggatgaaggcgggtctatgctctct
tcgtccagaggaaatcaatctccggtcgaaatggtggattgtctcggcttttacggagta
aagatgcttttttgtattggaggagacggcactcttcgaggcgctcgggagatcgtgaat
gaggtcgcgagaagaaagatggaaatttctgtcattggaattccgaagacgatcgacaac
gatatcaactacgtacaaaaaacattcggtttttctactgcgttttccaaggcgatggaa
gcggtggaatgtggacatgtggaagcgaaaggagcgccgaacggaatcggcttggtcaaa
ctgatgggacgtcattccggattcatcgcggtaaatgcggctctcgcttctaaaaacgta
aattattgcctaattcccgaagtgaattttgacctctatggaaatggagcgtttttggac
gatctcaaaaaaagaatccaaaagaagggacacgcggttatcatcgtggcggaaggagcc
gggcagaaatttttcgattcgacggaagaaagagacccttccgggaatctgaaactgggg
gatattggtcttttcctcaaggatacgatgactgagtttttcaaaaaagaaaacattcca
gtgaacatcaaatacatagatccgagttatatcattcgatcgattccggctaacgcggaa
gattccgtattctgtggttttttggctcaaaacgcggttcacgcggcaatggccggtaaa
accgatatggttgtgggaatgtggaacaacgtgttcatacatcttccgatttctcttgcg
attcaggaaagaaaagtgttgcaaccggacaaaagtactctttggagatctcttttggct
tccacgggtcagcccgcgcatatgttggccaaacattcagaggacagaaatgtaaattac
gtcagaatcatttga

DBGET integrated database retrieval system