KEGG   Lactobacillus brevis KB290: LVISKB_0118Help
Entry
LVISKB_0118       CDS       T02528                                 

Definition
(GenBank) Aldehyde-alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lbk  Lactobacillus brevis KB290
Pathway
lbk00010  Glycolysis / Gluconeogenesis
lbk00071  Fatty acid degradation
lbk00350  Tyrosine metabolism
lbk00620  Pyruvate metabolism
lbk00625  Chloroalkane and chloroalkene degradation
lbk00626  Naphthalene degradation
lbk00650  Butanoate metabolism
lbk01100  Metabolic pathways
lbk01110  Biosynthesis of secondary metabolites
lbk01120  Microbial metabolism in diverse environments
lbk01130  Biosynthesis of antibiotics
lbk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lbk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LVISKB_0118
   00620 Pyruvate metabolism
    LVISKB_0118
   00650 Butanoate metabolism
    LVISKB_0118
  Lipid metabolism
   00071 Fatty acid degradation
    LVISKB_0118
  Amino acid metabolism
   00350 Tyrosine metabolism
    LVISKB_0118
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LVISKB_0118
   00626 Naphthalene degradation
    LVISKB_0118
Enzymes [BR:lbk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LVISKB_0118
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LVISKB_0118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 TipAS
Motif
Other DBs
NCBI-ProteinID: BAN05753
UniProt: M5AAG2
Position
115813..118488
Genome map
AA seq 891 aa AA seqDB search
MIYLVKKLTRMFSKSGGIMMLKDVKENSKSKSKESAETVDQMIDRLTAKAHDALCAMDDF
TQEQVDHIVHQMSIAALDQHMVLAKAAFKETGRGVMEDKAVKNMYASEEIWHSIKHDKTV
GIIKDDHERQLITVAEPLGILAGVTPVTNPTSTTIFKSLIAVKTRNPIIFAFHPQAQQSS
VMAAKVVRDAAIAAGAPEGVIQWIETPSLEATTALMNHPMVASVLATGGPGMVKAAYSTG
KPALGVGPGNGPAYIEKTANIKRAVYDIVLSKTFDNGMVCASENSAVIDHEIYDDVKKEM
QDRGVFFIKKSDEKALADTMFKPEGGVKGPIPGMSAQKIADLAGIKVPAGTKVLAAEITG
VGPKFPLSQEKLCPMISVYKATSQENAFKLCDDLLHFGGLGHTASLHTMDDALATKFGIA
MKASRVLINTPSAIGGIGNLYNEMVPSLTLGTGSWGKNSVSHNVSSFDLLNIKTIAKRRN
NMQWIKLPRVYFEKTSVRYLDDMPGIKRVFLVTDPAMVELGYIDTVLNELKRQPNGIEYS
LFSDVEPDPTTDTVNRGVAQMRMFKPDTIVALGGGSAMDAAKNMWLFYEDPEASFFGAKQ
KFLDIRKRAYKFNKPHKAQFVAIPTTSGTGSEVTPFAVITDSKTHVKYPLADYALTPDVA
IVDSQFIETVPKKTVAYSGLDVLTHAIESYVSNMASDYTRPWSLQAIKLVMDNLTNSYNG
DITAREEMHNASTLAGMAFANAFLGIDHSIAHKLGGEFGLPHGLAIAITLPHVIRYNFKE
PTKLSMWPKYDHFKADEDYAQIARYLGLPGTTNEELKEALVKKIIDLAHSVDVTLSLKAN
GVDKAHFDQAVDKLAELAFEDQCTTANPREPLVSELKQIMLDEYDGKNVEK
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgatatatctcgtgaagaagttaacaagaatgttttcaaaaagtggaggcataatgatg
ttaaaagacgtgaaagagaattcaaaatcaaaatcaaaagaaagcgctgaaaccgttgac
cagatgatcgaccggttgacggccaaggcccatgacgccctgtgtgccatggatgacttt
actcaagaacaagtcgatcacatcgttcaccagatgtcgattgcagctttagatcagcat
atggttttagccaaggccgcttttaaagaaactggtcgtggagtgatggaagacaaggcc
gtaaagaatatgtatgcgagtgaagaaatttggcactctatcaagcatgacaaaacagtt
ggcattattaaggatgaccatgaacggcaattgatcacagttgctgaaccactgggaatt
ctggccggggtaacgcctgtcacgaacccgacgtcaaccactatctttaagtccctgatt
gcggttaagacgcggaaccccatcatctttgctttccatccacaagcccaacaatcttcg
gttatggcggccaaagttgttcgtgatgcggccatcgctgctggtgcaccagaaggggtt
attcaatggattgaaacgccaagcttggaagcaacgacagccttaatgaatcacccaatg
gttgccagtgtcttagcgaccggtggtcctggtatggtgaaggccgcttactcaactggg
aagccagccttaggggtgggtcctggtaacggtccagcttacattgaaaagacggcgaat
atcaaacgggccgtttatgacattgtcttatcgaagacctttgataacgggatggtttgt
gcctccgaaaacagtgcggtcattgaccatgaaatctatgatgacgttaaaaaagaaatg
caagaccgtggcgttttcttcattaagaagagcgacgaaaaggccctagctgacactatg
ttcaaaccagagggtggcgttaaaggcccaattccagggatgtcagcacaaaagatcgct
gatttggctgggatcaaggttcctgctggtacgaaggtgttagctgctgagattaccgga
gtcggaccaaagttcccattgtctcaagaaaaactatgtccaatgatttcagtttacaag
gcaacgagtcaggaaaatgccttcaagctttgtgatgacttgctccacttcggtggtctc
ggtcacacggcatctcttcacacaatggatgatgctttggcaacgaagtttgggattgcg
atgaaggctagtcgagtattgatcaataccccatctgctatcggtggtatcgggaacctt
tacaatgaaatggtgccatcattgaccttaggaacgggatcatggggtaaaaactctgtt
tcccataacgtttcttcctttgatttactgaacatcaaaacgattgcaaagcggcgaaat
aatatgcagtggattaaattacctcgggtttattttgaaaagacatcagttcgctacctc
gacgacatgccaggcatcaaacgggtattcttagttactgacccagccatggttgaactc
ggttacatcgacaccgtgctgaatgaattgaagcgtcaaccaaacggcattgaatactcc
ttgttctctgacgtggaacctgatccaacgacggatacggttaaccgtggggttgctcaa
atgcggatgttcaagccagatacaattgtggctttaggtggaggttcagcaatggatgct
gccaagaatatgtggttattctacgaagatccagaagccagcttctttggcgctaagcag
aaattcttggatatccggaaacgggcttacaagtttaacaagccgcacaaggcccaattt
gttgccattccaaccacttctggaacgggttcagaagtcacaccgtttgccgtgattacg
gattctaagactcacgtgaagtacccactggctgactatgccttaacgccagacgttgcg
attgtggattcccaatttatcgaaacggtccctaagaagacggtggcttactctgggtta
gacgttttaacccatgccattgaatcttacgtgtcaaacatggcttctgattacacccgg
ccatggtcattacaagcgattaaattagtgatggataacctgactaattcctacaacggt
gacattacagcgcgcgaagagatgcacaatgcttcaacgctagctgggatggcgtttgcc
aacgccttcttggggattgatcactcgattgcccacaagttgggtggcgaatttgggtta
cctcatggattggctattgccattaccttgccacacgttatccggtataacttcaaggaa
ccaacgaagttatccatgtggccaaagtatgatcacttcaaggctgatgaagactatgct
caaatcgcacgttacttgggtctgccaggaacgactaacgaagagctcaaggaagctctt
gtcaagaagatcattgatctggcccattccgttgatgtgaccttaagtctgaaggccaac
ggtgttgacaaagctcactttgaccaagcagtggacaagctagctgagttagcctttgag
gatcaatgtacaacggctaatccacgcgaaccactcgtatctgaattaaagcaaattatg
cttgatgaatacgatggtaagaacgttgaaaaataa

DBGET integrated database retrieval system