KEGG   Lactobacillus brevis KB290: LVISKB_0246Help
Entry
LVISKB_0246       CDS       T02528                                 

Definition
Glucan Endo-1 6-Beta-Glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
lbk  Lactobacillus brevis KB290
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lbk00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:lbk00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
250056..251390
Genome map
AA seq 444 aa AA seqDB search
MTTWIESTPDAYLTEKTPTTITATTSPDLQLTGERLQKLRGFGGCFNELGYLPLSKLPDD
QQQMIYRDLFSPEGLNFTFNRTPIGANDFAETWYSYDESDGDYALDDFSVAHDEQTLVPY
IRNAQRYQPNLELFASPWTPPTWMKFPKVYNFGRIVMTPENLQAYADYFVKYIRAYEKLG
IHIQRVCPQNEVFADQKFPSCRWHSEDLRIFIRDYLGPTFKQNNLDTEIFLGTLNGPEDM
SFDASGIKMDNYNRYVDNILFDDQARKYITGIGYQWAGQHAIERTHASWPEMELIQTESE
CGYGENTWQYAEYIFHLVNHYFTAGATAYTYWNMILGDTISTWGWHQNSMFSIDSKTQAV
TRNPEYYVMRHYAHYVKPGARVLATTGHFNSMGKAFRNPDGQVVVVVQNALNRELPFTFA
DPDQPDEGIQVTLAPNSFNTFVLD
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttggattgaaagtacgccggatgcgtatttaactgagaaaacacccacaacg
attacagcaaccacctcgccagatttgcaattgacaggagaacggttacagaaattgcgg
ggatttggcggttgttttaatgaactggggtacctacccctcagtaagttacccgatgat
cagcagcaaatgatttatcgtgatttattttcaccagaagggctgaactttacatttaat
cggaccccaattggggcgaatgatttcgcagaaacttggtacagttatgatgaaagcgat
ggggattatgcactggatgatttttcagtagcccatgatgaacagacgttggttccctat
attagaaatgcccagcgttatcaaccaaatttggaattatttgccagtccgtggacaccg
ccgacttggatgaagtttcctaaagtctataactttggacgaattgtgatgacacctgag
aatttacaggcgtatgcggattatttcgtcaagtacattcgggcttacgaaaaactaggt
attcatattcaacgtgtttgtccgcaaaatgaagtatttgccgaccagaagtttccatcc
tgtcgatggcatagtgaagacttacgtatctttattcgagattatcttggcccgacgttc
aagcaaaataacttggatactgaaatatttctggggacgctgaatggtccagaagacatg
tcatttgatgcatccggcattaaaatggataactataaccgctacgttgataatatttta
tttgatgaccaggcacgaaaatatatcacaggaattgggtatcaatgggctgggcaacat
gctatcgaacggacgcatgcgtcgtggccagaaatggagctgattcagactgaatcggaa
tgtggttatggtgaaaatacgtggcaatatgctgaatatattttccatttggtcaaccat
tacttcacagcaggagcaacagcttacacgtattggaatatgattctaggtgataccatt
agcacatggggatggcaccaaaactcgatgttttcaattgattctaagacacaagcagtc
acccgtaatcctgaatattatgttatgcggcattatgcacattatgtgaagccaggggct
cgcgtattagcgacaacgggacattttaactcaatgggaaaggcttttcgcaatccggat
gggcaagtggtcgtcgttgtccagaatgcattaaatcgcgaattaccgtttacctttgcc
gatcctgatcaaccggatgagggaattcaggtaacactagcgccgaactcattcaataca
tttgtactcgattaa

DBGET integrated database retrieval system