KEGG   Lactobacillus brevis KB290: LVISKB_0246Help
Entry
LVISKB_0246       CDS       T02528                                 

Definition
(GenBank) Glucan Endo-1 6-Beta-Glucosidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
lbk  Lactobacillus brevis KB290
Pathway
lbk00511  Other glycan degradation
lbk00600  Sphingolipid metabolism
lbk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbk00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    LVISKB_0246
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LVISKB_0246
Enzymes [BR:lbk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     LVISKB_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: BAN05881
UniProt: M5AXT7
Position
250056..251390
Genome map
AA seq 444 aa AA seqDB search
MTTWIESTPDAYLTEKTPTTITATTSPDLQLTGERLQKLRGFGGCFNELGYLPLSKLPDD
QQQMIYRDLFSPEGLNFTFNRTPIGANDFAETWYSYDESDGDYALDDFSVAHDEQTLVPY
IRNAQRYQPNLELFASPWTPPTWMKFPKVYNFGRIVMTPENLQAYADYFVKYIRAYEKLG
IHIQRVCPQNEVFADQKFPSCRWHSEDLRIFIRDYLGPTFKQNNLDTEIFLGTLNGPEDM
SFDASGIKMDNYNRYVDNILFDDQARKYITGIGYQWAGQHAIERTHASWPEMELIQTESE
CGYGENTWQYAEYIFHLVNHYFTAGATAYTYWNMILGDTISTWGWHQNSMFSIDSKTQAV
TRNPEYYVMRHYAHYVKPGARVLATTGHFNSMGKAFRNPDGQVVVVVQNALNRELPFTFA
DPDQPDEGIQVTLAPNSFNTFVLD
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttggattgaaagtacgccggatgcgtatttaactgagaaaacacccacaacg
attacagcaaccacctcgccagatttgcaattgacaggagaacggttacagaaattgcgg
ggatttggcggttgttttaatgaactggggtacctacccctcagtaagttacccgatgat
cagcagcaaatgatttatcgtgatttattttcaccagaagggctgaactttacatttaat
cggaccccaattggggcgaatgatttcgcagaaacttggtacagttatgatgaaagcgat
ggggattatgcactggatgatttttcagtagcccatgatgaacagacgttggttccctat
attagaaatgcccagcgttatcaaccaaatttggaattatttgccagtccgtggacaccg
ccgacttggatgaagtttcctaaagtctataactttggacgaattgtgatgacacctgag
aatttacaggcgtatgcggattatttcgtcaagtacattcgggcttacgaaaaactaggt
attcatattcaacgtgtttgtccgcaaaatgaagtatttgccgaccagaagtttccatcc
tgtcgatggcatagtgaagacttacgtatctttattcgagattatcttggcccgacgttc
aagcaaaataacttggatactgaaatatttctggggacgctgaatggtccagaagacatg
tcatttgatgcatccggcattaaaatggataactataaccgctacgttgataatatttta
tttgatgaccaggcacgaaaatatatcacaggaattgggtatcaatgggctgggcaacat
gctatcgaacggacgcatgcgtcgtggccagaaatggagctgattcagactgaatcggaa
tgtggttatggtgaaaatacgtggcaatatgctgaatatattttccatttggtcaaccat
tacttcacagcaggagcaacagcttacacgtattggaatatgattctaggtgataccatt
agcacatggggatggcaccaaaactcgatgttttcaattgattctaagacacaagcagtc
acccgtaatcctgaatattatgttatgcggcattatgcacattatgtgaagccaggggct
cgcgtattagcgacaacgggacattttaactcaatgggaaaggcttttcgcaatccggat
gggcaagtggtcgtcgttgtccagaatgcattaaatcgcgaattaccgtttacctttgcc
gatcctgatcaaccggatgagggaattcaggtaacactagcgccgaactcattcaataca
tttgtactcgattaa

DBGET integrated database retrieval system