KEGG   Lactobacillus brevis KB290: LVISKB_0678Help
Entry
LVISKB_0678       CDS       T02528                                 

Definition
Carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lbk  Lactobacillus brevis KB290
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
708822..709580
Genome map
AA seq 252 aa AA seqDB search
MIRKPTPLFFEQGPQAVILLHAYSGSSNDMRLLARRLQSENYTVLAPIFSGHATGDPADI
LRQGSPQQWWQDTQTAIANLRQRGYQQIAIFGLSLGGLFATRALMADPELQGGGTIASPV
IFRGQTNVPATFMQMAQADYQSQGLSVDEQTKRLAWLKEQLPAQLTAIQAFADTTATHLE
RVKQPVFIAQGDADQMIDPRSGQWLADAYPSEQIDFHEYAGAGHVLTVNAAHHVLETDIL
AFLQTIFKNNEE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgattcgaaaaccaaccccgctcttctttgagcagggacctcaagcagtgattctactg
cacgcttactccggtagttccaacgacatgcggttattggctcggcgacttcagagcgag
aattataccgtcttagcgcccatcttttcgggccacgcaaccggtgatcccgcggatatt
ttacggcagggttcaccacagcaatggtggcaagacacgcaaacagcgattgccaatttg
cggcagcgaggttaccaacagattgccatctttgggttgtctttgggcggcctctttgcg
acgcgggctttgatggctgacccagagttgcaaggtggtggcacgattgcgtcgcccgtt
atctttcgggggcagactaacgtgccagcaacatttatgcaaatggcccaggcggattat
cagtcacaagggttgtcagtcgatgaacagactaagcgcttggcctggctgaaggaacag
ctgccagcacaattgacagcaattcaggcatttgcagataccacggcgacccacttggag
cgtgtcaaacaaccggtctttattgcccagggtgacgcggatcagatgattgacccccgt
tctgggcaatggctagcagatgcttatccatctgaacaaattgattttcatgagtatgcc
ggtgccggccacgtgctgacggttaatgcggcacaccatgtattggaaacagacattttg
gcgtttttacaaacaatctttaaaaataacgaggaatag

DBGET integrated database retrieval system