KEGG   Lactobacillus brevis KB290: LVISKB_0774Help
Entry
LVISKB_0774       CDS       T02528                                 

Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lbk  Lactobacillus brevis KB290
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LVISKB_0774
Enzymes [BR:lbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LVISKB_0774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
805039..805698
Genome map
AA seq 219 aa AA seqDB search
MLVGRSNFPGQSAIIDRNCQKGGSNVAQLFFRYGAMNSGKTIEILKVAHNYEEQHKRVII
MTSGLDTRDEVGYIASRIGLKRQAHPIFQDTDLFEEIQRIDAQANCVLIDEAQFLTKAHV
FQLAKVVDELKIPVMTFGLKNDFRNELFEGSKYLLLYADKIEEMKTICWFCTKKAIMNLR
FHNDQPVYEGEQVQIGGNEAYYPVCRRHYFNPPLDQIGK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgctggttggacggtcgaattttccggggcaatcagctataatagatagaaactgtcaa
aaaggtgggagtaacgtggcgcagctattttttcggtatggtgcaatgaatagcgggaag
accattgaaatcttaaaggtcgcccataactatgaggaacaacataagcgagtgatcatc
atgaccagtggactagatacccgtgatgaggtcggttacatcgccagtcgaattggacta
aaacggcaagcacatcctatttttcaagacacggatctctttgaagaaattcaacgcatt
gatgcccaagcaaactgcgtattaatcgatgaagcgcagttcttgaccaaagcacatgtg
ttccagttggctaaggtagttgatgaactgaagattccggtcatgacgtttggcttaaag
aacgattttcgcaacgaattattcgaaggttccaaatacctgttgctatacgcagataaa
atagaagaaatgaagacgatttgctggttctgcaccaaaaaagcgattatgaatttgcgc
tttcacaatgaccaacccgtgtacgaaggcgaacaagtgcaaattggtggtaatgaagcc
tattaccccgtttgtcgtcgccactatttcaacccaccattagatcagattgggaaataa

DBGET integrated database retrieval system