KEGG   Lactobacillus brevis KB290: LVISKB_0930Help
Entry
LVISKB_0930       CDS       T02528                                 

Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lbk  Lactobacillus brevis KB290
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lbk03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
963337..964197
Genome map
AA seq 286 aa AA seqDB search
MPELPEVETVRRGLTRLVQGATIAHVEVRYPKMVTPDADVFTAELISRKIERIDRRGKYL
LFRFSGDLTMVSHLRMEGKYDVQPEGSPVSKHTHVIFHLTDNRELRYTDTRKFGRMQLVP
TGEETTLAPSLGKLGPEPTAETLTLAYMVKIFGKSHKVVKPFLLDQTRIAGLGNIYADEV
LWLSKINPLTPVDTLTPSQLSELRQNIIDEMALAIGGHGTTVHSFSTAFGEAGQFQNQLH
VYGREGEPCERCGTELVKIKVAQRGTHFCPHCQPLPPEAKAALIHD
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattacctgaagttgaaacggttcgacgcgggttgacgcgattggttcaaggg
gccactattgctcacgttgaggttcgttatccaaaaatggtcacacctgacgcggatgtc
tttaccgcggaattaatcagccggaaaattgagcggattgatcggcgaggaaaatacctg
ttattccgatttagtggtgacttaacgatggtgtcacacttgcgtatggaaggaaagtat
gacgtccagccagaaggtagccccgtttccaagcatacgcatgtgatctttcatttaact
gataatcgggagttgcgttataccgatacccggaagtttggccgaatgcaattagtgccg
acgggcgaagaaacaacgctggccccctcattgggcaaattgggaccggaaccaacggcg
gagaccttaacgttagcgtatatggtcaaaatctttggtaagtcacataaagtggtgaag
cctttcttattagatcagacgcgaattgctggattggggaatatctatgcagacgaggtc
ctgtggttatctaagattaatccactaacgccagtagatacgttaacgccgtctcaattg
tcggagctacgccaaaatattattgatgagatggctttagccattggggggcatggcacg
acagtccattcattttcgacagcgtttggtgaggctggtcagtttcaaaatcagttgcat
gtctatggccgagaaggtgaaccgtgcgaacggtgtggaacagaattggttaagattaag
gtggcccagcgtggtacgcatttctgcccgcactgccagccattaccaccagaagcaaag
gcggcgttgattcatgactga

DBGET integrated database retrieval system