KEGG   Lactobacillus brevis KB290: LVISKB_1368Help
Entry
LVISKB_1368       CDS       T02528                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lbk  Lactobacillus brevis KB290
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lbk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LVISKB_1368
Enzymes [BR:lbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LVISKB_1368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1380262..1381182)
Genome map
AA seq 306 aa AA seqDB search
MANKVTVLGSLNVDTTLRIARMPQPGETLSTENKSSAAGGKGANQAVAAARAGAETSFIG
KVGNDDAGRFMVESLDNDHIDTHAIITDPVVGTGSAFILLDEAGQNSILVYGGSNQQIKA
EEVIAREDEIANADFLITQFETPQAATLAAFKVAKQHGVTTILNPAPAAEIDPEILKVTD
LVIPNETESAELTGIEVTDEASMDANAKKFREMGVKNLIITVGSKGAYYATEQESGFVPA
FKVKAVDTTAAGDTFIGALSSQLKPDLSNVAMALVFAQRASSLTVQGLGAMPSIPTVEQI
EAASKK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataaagtaacggttctgggaagtttgaatgttgatacgacgctacggatcgcg
cggatgccgcaaccaggggaaacattatcgactgaaaacaagagtagtgctgctggcggt
aagggtgccaaccaagcggtagctgctgcacgggccggagccgaaacaagctttattggt
aaggtggggaatgatgatgctggtcgtttcatggtagagtcattagataatgaccacatt
gatacacacgcaatcattaccgatccagttgtaggaaccgggtctgccttcattctcttg
gatgaagctggtcagaacagtatcttggtttatggtggttctaaccaacagattaaggcc
gaagaagtcattgctcgtgaagatgaaattgccaatgctgatttcttaattacccagttt
gaaacgccacaagcagcgaccttggcagcatttaaagtggctaagcaacacggggtaaca
actattttgaacccggcaccagctgctgaaattgatccagagattctaaaagtgacggat
ttggtcatccctaacgaaacggaaagcgcggagttaactggaatcgaggtaacagacgaa
gcctcaatggatgccaatgcgaagaagttccgagaaatgggtgttaagaacctgattatc
acagttgggagtaaaggcgcttactacgcaactgaacaggaatccggatttgtgccggcc
tttaaggttaaagctgtggatacgaccgcagctggagatacctttattggtgctttgagt
tcacaattgaagccagatcttagtaatgttgcaatggcgttggtcttcgcgcaacgggca
agttccttaacagtgcaaggtttgggtgctatgccatctatcccaacggttgaacaaatt
gaggccgctagcaagaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system