KEGG   Lactobacillus brevis KB290: LVISKB_1690Help
Entry
LVISKB_1690       CDS       T02528                                 

Definition
Alpha-galactosidase 1
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lbk  Lactobacillus brevis KB290
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lbk00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lbk00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lbk00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1714950..1717181)
Genome map
AA seq 743 aa AA seqDB search
MKGIDAMSIHVNEANLTFHLQTDHTSYIFQIMKNGEAGQIYYGPRIHVQPTYQNLMSQEW
RDATPSLNEENPNFQPATIKAEYASLGKGDFRQPAFQVTQANGSRITELTYDHYQLLTGK
QRLANLPSTFDDTDDDAQTLVVSFNDRITGLALDLNYSIFPHQDVIVKSTKFTNPSSEKL
VLNRALSSQLDLPDANYDLIQFSGTWARERHLYRHPLRSGMQSISSLRMASSHQQNPFMM
LARPQTTDEQGAVFGFNLVYSGNFLDAIEVDQYSTSRILTGINPDEFGWNLAPQATFQTP
EAILSYTSAGMNQLSQQMASFYQQHLVNPRFAHEERPVLINNWEATYFDFNEAKLMTIVN
QAKRLGIEMFVLDDGWFGHRDDDTTSLGDWFVDQRKFPDGIEHFSQAVHQQGMKFGLWFE
PEMVSVDSDLYQQHPDWLIHAPKSTPTPGRHQFVLDMARPEVVDYLFKLMSQMIESANLD
YIKWDMNRYATEMFSSRLTSDQQLELPHRYILGVYQLYARLTQAYPNVLFESCASGGGRF
DLGMMYYAPQAWTSDDTDAAERLLIQFGTSYGYPQAMMGAHVSAVPNDQMGRITSLKTRG
AVAFFGDLGYELDITKMAPTELDQVKKQVAFYKCYRQLFQFGKFYRIDSPFVGDGNVTSW
QVVSDDQKQAIAARYQLLNHPNAPYTRFYFKGLRPNQRYQINDDPSTYYGDELMNAGYFV
PTILADGQESKDFYTQLFVVTAI
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggaatcgatgctatgtcaatccatgtcaatgaagctaatcttacgtttcattta
caaaccgatcacacgagttatatttttcaaattatgaaaaatggcgaggccggtcagatt
tattatggaccaagaatccacgtgcaaccgacctatcaaaatctcatgtcacaggaatgg
cgtgatgcgacaccgtcattgaacgaagaaaacccgaattttcagccagctacgatcaag
gctgagtatgcgagcttgggtaagggtgatttccggcaaccggcttttcaagtgacccaa
gcaaatgggagccggattaccgagttgacttatgatcattaccaactactaacagggaaa
cagcgattagccaacttgccatcaacgtttgatgataccgacgatgatgcccaaacatta
gtcgtgtcctttaacgatcggattaccgggttggcacttgaccttaattatagtattttt
ccacaccaagatgtcattgtaaaaagtacgaagtttaccaatccaagttccgaaaaatta
gttctgaatcgggcgcttagttctcaattagatttaccggatgccaattatgacctaatc
caattttctggtacgtgggcgcgtgaacggcatctgtatcgtcatccattacgatcggga
atgcagagtattagtagcctacggatggcctcaagtcaccaacaaaaccccttcatgatg
ttggcccgcccacagacgaccgacgagcaaggggcggtctttggcttcaatttagtttat
tccggtaattttttggatgccattgaagttgaccaatacagtaccagccggattctgacc
ggaatcaatccagacgaatttggttggaatctggccccgcaagcgacatttcagactccc
gaggcaattttgagttatacctcagccggaatgaaccaactgtcacagcaaatggccagt
ttttatcagcagcatttggttaatccgcgatttgctcatgaggaacggccggtgctgatt
aataattgggaggccacttactttgactttaacgaagcgaagttgatgacgattgttaac
caggctaagcgactgggaattgagatgtttgtgctggatgatggctggtttggccaccgg
gatgacgacaccacctccttaggggactggtttgtcgatcagaggaagtttccggatggc
atcgaacacttcagtcaagcagttcatcagcaagggatgaagtttggtttgtggtttgaa
ccggaaatggtttctgttgatagtgacctttaccaacagcatcccgactggttgattcat
gcacccaaatcgacgccaacgcctggtcgccaccagttcgttttggatatggcgcggcca
gaagtggtcgattacctatttaagctgatgagtcagatgattgaatcggcgaacttggac
tacatcaagtgggatatgaaccgctatgcgacggaaatgtttagttcaaggttaactagt
gatcagcaattagaactgccgcatcgatatattctaggcgtttatcagttgtatgctcga
ctaacgcaggcctatccgaatgttttgtttgaatcctgtgcgtccggtgggggccggttc
gatctggggatgatgtattatgcgccgcaagcgtggacgagtgatgatactgatgcggca
gaacgcctgctgattcaattcgggacgtcctatgggtatccacaagccatgatgggagcc
cacgtctctgcggttccaaatgaccagatggggcggatcacgtcgctaaagaccagaggg
gccgtagcgttcttcggtgatttggggtatgaactcgatattaccaagatggcgccaacg
gaattggaccaagtcaaaaaacaagtggccttttataaatgttatcgccagcttttccaa
tttggaaagttttaccgaatcgacagtccctttgtgggggacggcaatgtcactagttgg
caggttgtgagtgacgaccagaaacaagcgattgccgcccggtaccaactgttgaatcat
cccaatgcgccttatacccgcttctatttcaagggattacgtcctaatcagcgctatcaa
attaatgatgacccatcaacctattatggggatgaattaatgaatgctggttattttgtc
ccaaccattttggcggacggccaagagtctaaagacttttatacccagttgtttgtggtg
acggcaatttag

DBGET integrated database retrieval system