KEGG   Lactobacillus brevis KB290: LVISKB_1690Help
Entry
LVISKB_1690       CDS       T02528                                 

Definition
Alpha-galactosidase 1
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lbk  Lactobacillus brevis KB290
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lbk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LVISKB_1690
  Lipid metabolism
   00561 Glycerolipid metabolism
    LVISKB_1690
   00600 Sphingolipid metabolism
    LVISKB_1690
Enzymes [BR:lbk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     LVISKB_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1714950..1717181)
Genome map
AA seq 743 aa AA seqDB search
MKGIDAMSIHVNEANLTFHLQTDHTSYIFQIMKNGEAGQIYYGPRIHVQPTYQNLMSQEW
RDATPSLNEENPNFQPATIKAEYASLGKGDFRQPAFQVTQANGSRITELTYDHYQLLTGK
QRLANLPSTFDDTDDDAQTLVVSFNDRITGLALDLNYSIFPHQDVIVKSTKFTNPSSEKL
VLNRALSSQLDLPDANYDLIQFSGTWARERHLYRHPLRSGMQSISSLRMASSHQQNPFMM
LARPQTTDEQGAVFGFNLVYSGNFLDAIEVDQYSTSRILTGINPDEFGWNLAPQATFQTP
EAILSYTSAGMNQLSQQMASFYQQHLVNPRFAHEERPVLINNWEATYFDFNEAKLMTIVN
QAKRLGIEMFVLDDGWFGHRDDDTTSLGDWFVDQRKFPDGIEHFSQAVHQQGMKFGLWFE
PEMVSVDSDLYQQHPDWLIHAPKSTPTPGRHQFVLDMARPEVVDYLFKLMSQMIESANLD
YIKWDMNRYATEMFSSRLTSDQQLELPHRYILGVYQLYARLTQAYPNVLFESCASGGGRF
DLGMMYYAPQAWTSDDTDAAERLLIQFGTSYGYPQAMMGAHVSAVPNDQMGRITSLKTRG
AVAFFGDLGYELDITKMAPTELDQVKKQVAFYKCYRQLFQFGKFYRIDSPFVGDGNVTSW
QVVSDDQKQAIAARYQLLNHPNAPYTRFYFKGLRPNQRYQINDDPSTYYGDELMNAGYFV
PTILADGQESKDFYTQLFVVTAI
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggaatcgatgctatgtcaatccatgtcaatgaagctaatcttacgtttcattta
caaaccgatcacacgagttatatttttcaaattatgaaaaatggcgaggccggtcagatt
tattatggaccaagaatccacgtgcaaccgacctatcaaaatctcatgtcacaggaatgg
cgtgatgcgacaccgtcattgaacgaagaaaacccgaattttcagccagctacgatcaag
gctgagtatgcgagcttgggtaagggtgatttccggcaaccggcttttcaagtgacccaa
gcaaatgggagccggattaccgagttgacttatgatcattaccaactactaacagggaaa
cagcgattagccaacttgccatcaacgtttgatgataccgacgatgatgcccaaacatta
gtcgtgtcctttaacgatcggattaccgggttggcacttgaccttaattatagtattttt
ccacaccaagatgtcattgtaaaaagtacgaagtttaccaatccaagttccgaaaaatta
gttctgaatcgggcgcttagttctcaattagatttaccggatgccaattatgacctaatc
caattttctggtacgtgggcgcgtgaacggcatctgtatcgtcatccattacgatcggga
atgcagagtattagtagcctacggatggcctcaagtcaccaacaaaaccccttcatgatg
ttggcccgcccacagacgaccgacgagcaaggggcggtctttggcttcaatttagtttat
tccggtaattttttggatgccattgaagttgaccaatacagtaccagccggattctgacc
ggaatcaatccagacgaatttggttggaatctggccccgcaagcgacatttcagactccc
gaggcaattttgagttatacctcagccggaatgaaccaactgtcacagcaaatggccagt
ttttatcagcagcatttggttaatccgcgatttgctcatgaggaacggccggtgctgatt
aataattgggaggccacttactttgactttaacgaagcgaagttgatgacgattgttaac
caggctaagcgactgggaattgagatgtttgtgctggatgatggctggtttggccaccgg
gatgacgacaccacctccttaggggactggtttgtcgatcagaggaagtttccggatggc
atcgaacacttcagtcaagcagttcatcagcaagggatgaagtttggtttgtggtttgaa
ccggaaatggtttctgttgatagtgacctttaccaacagcatcccgactggttgattcat
gcacccaaatcgacgccaacgcctggtcgccaccagttcgttttggatatggcgcggcca
gaagtggtcgattacctatttaagctgatgagtcagatgattgaatcggcgaacttggac
tacatcaagtgggatatgaaccgctatgcgacggaaatgtttagttcaaggttaactagt
gatcagcaattagaactgccgcatcgatatattctaggcgtttatcagttgtatgctcga
ctaacgcaggcctatccgaatgttttgtttgaatcctgtgcgtccggtgggggccggttc
gatctggggatgatgtattatgcgccgcaagcgtggacgagtgatgatactgatgcggca
gaacgcctgctgattcaattcgggacgtcctatgggtatccacaagccatgatgggagcc
cacgtctctgcggttccaaatgaccagatggggcggatcacgtcgctaaagaccagaggg
gccgtagcgttcttcggtgatttggggtatgaactcgatattaccaagatggcgccaacg
gaattggaccaagtcaaaaaacaagtggccttttataaatgttatcgccagcttttccaa
tttggaaagttttaccgaatcgacagtccctttgtgggggacggcaatgtcactagttgg
caggttgtgagtgacgaccagaaacaagcgattgccgcccggtaccaactgttgaatcat
cccaatgcgccttatacccgcttctatttcaagggattacgtcctaatcagcgctatcaa
attaatgatgacccatcaacctattatggggatgaattaatgaatgctggttattttgtc
ccaaccattttggcggacggccaagagtctaaagacttttatacccagttgtttgtggtg
acggcaatttag

DBGET integrated database retrieval system