KEGG   Leptospira borgpetersenii L550: LBL_0066Help
Entry
LBL_0066          CDS       T00405                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lbl  Leptospira borgpetersenii L550
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LBL_0066 (recR)
DNA repair and recombination proteins [BR:lbl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LBL_0066 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:74457..75050
Genome map
AA seq 197 aa AA seqDB search
MANHLLEEMVDALSSLPGIGRKSAFRISFHLLRLEQGHFNHFIHQLTNTKNKIKFCKRCG
SYAETEICNICTSEKRDTHTFCVVEQPEDIFFIENTREFHGKYHVLNGVISPLEGIGPKD
LRIKELLERIEPEQIKEVLVATNPTLEGDATADYLASQLKPLSVDVTRIAYGITVGGSIE
LADQYTLGRAIRSRLQL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttggctaatcatcttcttgaagaaatggtggatgctctctcttcgcttccggggatcgga
agaaagagtgcttttagaattagttttcaccttttaagacttgaacagggtcattttaat
catttcattcaccaactcacgaacacgaaaaacaaaatcaaattttgcaaacgatgcggt
tcttatgcggaaacggaaatttgcaacatctgtacctcggaaaaaagagatacccacaca
ttctgtgtcgtggaacaaccggaagacattttttttatcgaaaacacaagagaatttcac
ggcaaatatcacgtgttaaacggagtaatctcccctttggagggaattggaccgaaagat
cttagaatcaaagaacttttggaaagaatcgaaccagaacaaataaaagaagttttggtc
gccacgaacccaactcttgaaggagatgcaaccgcagattatttagcgagtcagttaaaa
cccctttctgtcgacgttactcgaattgcttacgggattacggtcggaggctcgattgaa
cttgcagaccaatacactttgggaagagccattcgttcccgtcttcagctttaa

DBGET integrated database retrieval system