KEGG   Leptospira borgpetersenii L550: LBL_0125Help
Entry
LBL_0125          CDS       T00405                                 

Gene name
acsA
Definition
(GenBank) Acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
lbl00010  Glycolysis / Gluconeogenesis
lbl00620  Pyruvate metabolism
lbl00640  Propanoate metabolism
lbl00680  Methane metabolism
lbl01100  Metabolic pathways
lbl01110  Biosynthesis of secondary metabolites
lbl01120  Microbial metabolism in diverse environments
lbl01130  Biosynthesis of antibiotics
lbl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBL_0125 (acsA)
   00620 Pyruvate metabolism
    LBL_0125 (acsA)
   00640 Propanoate metabolism
    LBL_0125 (acsA)
  Energy metabolism
   00680 Methane metabolism
    LBL_0125 (acsA)
Enzymes [BR:lbl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LBL_0125 (acsA)
Lipid biosynthesis proteins [BR:lbl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LBL_0125 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABJ77746
UniProt: Q056J9
Position
1:complement(145894..147858)
Genome map
AA seq 654 aa AA seqDB search
MAKERIVLPSAEFKKNSNITLKDYKSLYKESIENPNKFWAKEANRLTWFKKWTKVLNHDF
KNAKVEWFKGGKLNVSYNCLDRHISTPLKNKAALIWEGDNPSESKVLTYYDVYREVNRFA
NVLKKYGVKKGDRVLVYLPMIPELAITILACTRIGAIHSVVFGGFSPEALQSRIDDCKPK
LIVTADGGFRGGKPIELKRNVDIALEKSKEDVKTVIVVRRTGNESGLVWKDGRDYWYHFL
ISDPDLSPYCKPESMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLGVNLTFHYVFDIKPE
DTYWCTADIGWVTGHSYLVYGPLSNGASSVMFEGVPSYPDAGRFWDVIDKYGVNIFYTAP
TAIRALMREGLTHVQKRNLSSLRLLGSVGEPINPEAWEWYFKIIGKEKCPIVDTWWQTET
GSIMITALPGAIPQKPGSATLPFFGVQPVLVDNDGKEINDKGEVSGNLCIKSPWPSMMRG
VYGDSKRFFDTYFSQFKGYYFTGDGARRDKDGYYWITGRVDDVINVSGHRIGSAEVESAL
VENRSVAEAAVVGFPHDIKGQGIYAYVTVKEGIATNDTLKKELVAIVEKVIGKIARPDVI
HWAPSLPKTRSGKIMRRILRKIASGEFEGLGDTSTLADPSVVQKLIEDKRKFHS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaacgaatagttttaccatccgcggaatttaaaaagaattcaaacattacc
cttaaggattataaatctctttataaagaatccattgagaacccgaacaaattttgggca
aaagaagcgaatcgactgacctggtttaaaaaatggaccaaggttttaaatcacgatttt
aaaaatgcaaaagtggaatggttcaaaggcggaaaactcaacgtttcctacaattgtcta
gatcgtcacatcagtactcctttgaaaaacaaagccgctttgatctgggaaggagataat
ccttcggaatccaaagtccttacgtattacgacgtttacagagaggtaaatcgttttgcg
aacgttctcaaaaaatatggagtaaaaaaaggagatcgggttcttgtttatctccctatg
atcccggaattagcaattacgattcttgcatgtactcgaattggcgcaattcattccgtt
gttttcggaggtttttctccggaagcgcttcaaagtagaatcgacgattgtaaaccgaag
ttgatcgtcaccgccgacggaggtttccgaggcggtaaacccatcgaactcaaaagaaac
gtcgacattgctctcgaaaagtccaaagaggatgttaaaacggtaattgttgttcgtcgt
acaggaaacgaatccggtctagtttggaaagacggccgggattattggtatcattttttg
atcagcgatcccgatttatccccttattgtaaaccggagtccatggatgcggaagatcct
ctttttattctttatacttccggttcaacgggaaaaccgaaaggagttttacatactacg
ggcggttatcttctcggagttaatttaacatttcattatgtattcgatataaaaccggaa
gacacatattggtgcactgcggacataggttgggtgacgggtcattcttacttagtttat
ggtcccttgtccaacggagcctcttctgtgatgtttgaaggagtgccttcgtatccggac
gcaggaagattttgggacgttatcgataagtacggagtgaatatcttttatacggctcca
accgcgattcgtgctttgatgagagaagggttgactcacgttcaaaaaagaaatttgagt
tctttacgtcttctaggttccgtcggagaaccgatcaaccccgaagcttgggaatggtat
tttaaaattatcggaaaagaaaaatgtccaatcgtggatacctggtggcaaaccgaaacc
ggatccattatgatcactgcgttacccggagccatcccacaaaaaccgggttcggctact
ttaccgtttttcggagttcagcccgtattagtggacaacgacggaaaagaaataaacgac
aaaggagaagtttccggaaatttgtgtatcaaaagtccttggccgtcgatgatgcgtgga
gtttacggagattcgaaacgattttttgatacatatttctctcaattcaaaggatattat
tttacaggagatggagcgcgcagagataaagacggttactattggattaccgggcgtgta
gatgacgtaattaatgtttccggtcatagaatcggaagtgcagaagtcgaaagtgcgctc
gttgaaaatagatccgttgccgaggccgctgtagtcggattccctcacgacatcaaagga
caggggatatatgcttatgtaaccgtaaaggaaggtattgcgactaatgataccttgaaa
aaagaactcgttgcaattgttgaaaaggtaatcggcaaaattgcgagaccggacgtgatt
cattgggcgccgagtcttccaaaaactcgttccggaaaaattatgagaagaattttaaga
aagattgcttcgggagaattcgaaggcctcggtgatacttcgactctcgcggatccgtcg
gtggttcaaaaattgatcgaagataaaagaaaattccacagttaa

DBGET integrated database retrieval system